Background

Pressure injuries, also known as pressure ulcers, are common in bed-ridden patients, and associated with poor quality of life as well as high medical care costs [1, 2]. Pressure injuries have also been associated with poor prognosis and higher mortality in some patients [3]. Deep tissue injuries can rapidly develop into open ulcers, exposing wounded tissue to the external environment. Therefore, in clinical wound care and nursing specialties, the development of effective treatments for deep tissue pressure injuries is urgently required.

Inflammatory responses and reductions in capillary density caused by ischemia/reperfusion are the main factors that affect deep tissue injury healing [4, 5]. The main principles of deep tissue injury management are in the inhibition of inflammatory responses in conjunction with the restoration of blood microcirculation within the wound site [4, 6,7,8]. However, there are limited therapeutic drugs that can achieve these desirable effects; hence, there is an urgent requirement for the development of new, effective means to satisfy the unmet clinical need for the treatment of deep tissue injuries.

LL-37 is the only antimicrobial peptide of the cathelicidin family that has been identified in humans [9]. Recent studies have highlighted the important roles that antimicrobial peptides play in the regulation of wound healing [10]. In addition to bactericidal actions, LL-37 can also bind to Toll-like receptors (TLRs), inhibit TLR signaling pathways and reduce the production of proinflammatory cytokines [11]. LL-37 also contributes to blood vessel formation and has been shown to act as a practical immune adjuvant [12, 13]. Local injection of LL-37 significantly increased ischemic hind limb collateral circulation in animal models [14]. In clinical trials, it was found that supplementation with LL-37 was safe and was well tolerated when applied to nonhealing venous leg ulcers (VLUs) [15]. The major challenge associated with LL-37 administration is its rapid degradation within the wound environment; thus, treatments require higher dosage and dosing frequencies to achieve the desired therapeutic effect [16].

Recent research has shown that hydrogel dressings are an attractive option for use as small molecule drug delivery systems [17, 18]. Hydrogel dressings not only provide a moist healing environment for in vivo local injury tissues but also function as an extracellular matrix-like scaffold for cellular support while maintaining the biological activity of loaded small molecule polypeptides [19,20,21]. Multiple reports have shown that Chitosan (CS) hydrogels have strong potential for use in both pharmaceutical and medical applications [22, 23]. CS hydrogels are also widely used as drug delivery systems and wound dressings due to their mucoadhesive properties [24]. Previously, CS hydrogel wound dressings were prepared and successfully loaded with small molecular peptides for application in the treatment of lower limb ischemic disease [25]. In light of these reports, CS was selected as an appropriate base material for the hydrogels used in this study. Hydrogels were fabricated at a concentration of 2.5% CS (w/v), as it was previously reported that CS hydrogels at this concentration have suitable biocompatibility and fast degradation profiles [26].

In the present study, LL-37/CS hydrogel dressings were prepared using physical blending methods. The therapeutic effects were assessed, and molecular mechanisms of action were evaluated in deep tissue injuries through the use of molecular biology techniques. The results obtained in this study provide a theoretical basis for further investigations into the clinical application of LL-37/CS hydrogel dressings.

Materials and methods

Reagents

All reagents were purchased from Sigma-Aldrich unless otherwise stated. LL-37 (95% purity, [LL-37, 37 aa]) was synthesized by GL Biochem (Shanghai, China). NIH3T3 cells were purchased from the Chinese Academy of Medical Sciences (Tianjin, China). Fetal bovine serum (FBS) and trypsin were purchased from Gibco (Thermo Fisher Scientific, Waltham, MA, US); Medium 1640 was purchased from HyClone (GE Healthcare, Chicago, IL, US); Cell Counting Kit-8 (CCK-8) was purchased from Dojindo (Kumamoto, Japan).

Preparation of LL-37/CS hydrogel

CS hydrogels were prepared as previously described [27, 28]. Differing qualities of LL-37 powder were gradually dissolved in phosphate-buffered saline (PBS). The CS hydrogel solution was filtered through 0.22-μm filter membranes (Millex, Merck Millipore, Burlington, MA, US), and the LL-37 solution was slowly added under magnetic stirring (600 r/min × 5 min) at 4 °C.

Encapsulation efficiency

The encapsulation efficiency of LL-37 within CS hydrogels was determined by measuring the amount of non-encapsulated LL-37 still present within the supernatant after hydrogel formation and after 1 mg of lyophilized LL-37/CS hydrogel was dissolved in 1 ml of water. The concentration of LL-37 that was encapsulated within CS hydrogels was analyzed by HPLC using conditions reported in the literature [29]. A calibration curve was plotted for the LL-37 peptide concentration range from 1 ng/ml to 25,000 ng/ml. The LL-37 concentration was quantified, and the encapsulation efficiency of LL-37 was calculated using the following equation: Encapsulation efficiency = [Encapsulated LL-37/Initial LL-37] × 100%.

Antimicrobial activity

Antimicrobial activity was compared among LL-37 (5 μg/ml), LL-37/CS hydrogel (LL-37, 5 μg/ml) and CS hydrogel using Staphylococcus aureus bacterial culture. Briefly, a total of 1 × 105Staphylococcus aureus bacterial cells were added to 1 ml of PBS containing LL-37 or hydrogels and incubated for 6 h at 37 °C. A series of aliquots (100 μl) were taken and diluted in PBS to yield 1 × 103 bacteria per ml solution, and then plated on LB agar and incubated for 24 h at 37 °C before colonies were counted.

Cell culture

NIH3T3 cells were cultured in DMEM (Gibco) supplemented with 10% FBS containing antibiotics (100 U/ml penicillin and 100 μg/ml streptomycin. Cells were maintained at 37 °C in a humidified 5% CO2 atmosphere. Cells were subcultured every 2–3 days or when a confluent monolayer had formed.

Cytotoxicity assay

Cytotoxicity to NIH3T3 cells was examined using CCK-8 assays. The experiment was grouped into: control (saline), LL-37/CS (containing various concentration of LL-37: 10 ng/ml, 50 ng/mL, 100 ng/ml), CS with 6 replicate wells per group. Briefly, cells were seeded in 96-well plates at a density of 1 × 105 cells/ml, grown to 70–80% confluence, and incubated with LL-37/CS hydrogel or free LL-37 at various concentrations for 24 or 48 h. After two washes with PBS, cell viability was assessed using a CCK-8 assay kit (Dojindo). Absorbance was measured at 450 nm. The results are expressed as the percentage of control cultures.

Enzyme-linked immunosorbent assay (ELISA)

ELISA was used to assess the release of tumor necrosis factor-α (TNF-α) from macrophages. RAW 264.7 cells (1 × 105) were seeded into 96-well culture plate. After 24-h culture, the DMEM medium was replaced by DMEM containing 20 ng/ml lipopolysaccharide (LPS) and either LL-37 (5 μg/ml), LL-37 (5 μg/ml)/CS hydrogel, or CS hydrogels at an equivalent CS concentration. For negative control, 1% FBS-supplemented DMEM was used. For positive control, 1% FBS-supplemented DMEM containing 20 ng/ml LPS was used. Following an 18-h incubation time, the supernatant was collected, and TNF-α release was quantified by ELISA kit (No. 1217202, Dekewe Biotech, China).

In vivo wound healing study

Animals

Male C57BL/6 mice (6–8 weeks of age, approximately 20 g) were acquired from Beijing Vital River Laboratory Animal Technology (Beijing, China), and maintained in the Qingdao University Veterinary Service Center (Qingdao, China). Experiments were performed in compliance with the guidelines established by the Institutional Animal Care and Use Committee of Qingdao University (Qingdao, China).

Deep tissue injury

Hair of the right hind limb of the mouse was shaved using hair clippers. An area close to the gluteus superficialis muscle was subjected to pressure using a magnet (12-mm diameter, 5-mm thickness, 2.4 g weight, 1000 G surface magnetic flux) under a 12/ h under pressure and 12 h schedule. During the 12-h period with pressure, the mice had unlimited access to food and water, and allowed to move in the cage freely. One day after the paradigm started, mice randomly received subcutaneous injection of 20-μg LL-37, 20-μg LL-37/CS, or CS hydrogel alone (n = 6) into deep tissue under the magnet. A group of mice received magnet but no other intervention was included as a control. On day 21, the mice were sacrificed by severing the neck to obtain tissue for further analysis.

Evaluation of wound healing

Wound healing was evaluated by measuring the wound area on days 1, 3, 5, 7, 9, 11, 13, 15, 17, 19 and 21. Wound sites were photographed, and the wound area was measured using ImageJ analysis software (NIH, Bethesda, MD, US). Wound closure was expressed as the percentage of the initial wound area. The healing ratio was calculated using the following equation:

$$ \%\mathrm{original}\ \mathrm{wound}\ \mathrm{area}=\frac{\left(\mathrm{wound}\ \mathrm{area}\ \mathrm{at}\ \mathrm{day}\ \mathrm{X}\right)}{\left(\mathrm{wound}\ \mathrm{area}\ \mathrm{at}\ \mathrm{day}\ 3\right)}\times 100\% $$

Histological analysis of wound healing

Three mice were selected from each group, and the ulcer site and the surrounding tissue (approximately 1-cm radius) were excised, fixed in 4% paraformaldehyde for 24 h, and then transferred to PBS for storage at 4 °C until further use. Samples were embedded in paraffin, cut into three 5-μm-thick sections, and stained with hematoxylin and eosin (H&E). Five random visual fields of each section were selected to conduct histological analysis.

Reverse transcription (RT-PCR) and quantitative real time-polymerase chain reaction (qRT-PCR)

Total RNA was isolated using Trizol reagent (#RP1001, BioTeke, Beijing, China) and reverse-transcribed into cDNA using the First-Strand cDNA Synthesis System kit with random oligo primers. Samples were stored at − 20 °C until use in qRT-PCR. Primers were designed to be specific for mouse mRNA expression and for use in qRT-PCR analysis (Exicycler 96, Bioneer, South Korea). Nuclease-free water was used in place of the sample for negative control. β-actin was used as the internal control. Every sample was tested in duplicate. Melting curves were analyzed for each run to assess the presence of non-specific PCR products. The results were analyzed using Step One Software V2.1. The mRNA expression of interleukin-6 (IL-6), interleukin-10 (IL-10), TNF-α and transforming growth factor-β (TGF-β1) genes was calculated relative to the expression of the β-actin and according to the ΔΔCt method.

Western blotting

Total protein was extracted using a standard procedure [30], separated on an 8–12% polyacrylamide gel (SDS-PAGE) and then transferred to a PVDF membrane (No. IPVH00010, Millipore, USA). vascular endothelial growth factor-A (VEGF-A, 1:500, No. WL03335, Wanleibio, Beijing, China), hypoxia inducible factor-1α (HIF-1α, 1:500, No. WL01607, Wanleibio, Beijing, China), transforming growth factor-β1 (TGF-β1; 1:500, No. WL02998, Wanleibio, Beijing, China) and β-actin (1:100, No. WL01372, Wanleibio, Beijing, China) were used as primary antibodies. Secondary antibodies were used at a 1:10,000 dilution, and protein expression was detected using an ECL assay (No. WLA003, Wanleibio, Beijing, China). Densitometry was conducted using the Gel Image Processing System (Gel-Pro Analyzer, Meyer Instruments, Houston, TX, USA). The immunoblots shown are representative of at least three independent experiments.

Statistical analysis

Data are presented as the mean ± standard deviation (SD), and analyzed using two-way ANOVA followed by Tukey’s test for pairwise comparison using GraphPad Prism 7.00 (v7.Ii.0; San Diego, CA, USA). P < 0.05 was considered statistically significant.

Results

Preparation and characterization of LL-37/CS

CS hydrogels (2.5% w/v) containing various final concentrations of LL-37 were prepared: 0.1% w/w, 0.25% w/w and 0.5% w/w. Following gelation, stable hydrogels formed within minutes (Fig. 1a). Scanning electron microscopy (SEM) showed morphological characteristics common to freeze-dried hydrogels (Fig. 1b), indicating that all hydrogels had a porous network structure with homogeneous interconnectivity. The diameter of the porous network structure (range: 50–100 μm) was sufficient to incorporate and release LL-37 peptide. Encapsulation of LL-37 did not appear to affect the gelation performance of CS hydrogels. The encapsulation efficiency of LL-37 within CS hydrogels was 86.16% ± 2.61% (Fig. 1c) when LL-37 was loaded at 5 μg per mg CS hydrogel. Total amount of LL-37 within each hydrogel (0.1 ml) was 4.31 ± 0.13 μg.

Fig. 1
figure 1

Schematic representation of mechanisms and Characterization of LL-37/CS hydrogel. a. This figure shows the mechanisms of action of LL37/CS hydrogel in deep tissue pressure injury healing processes; b. A representative image of the LL-37/CS hydrogel; C. SEM photographs of the LL-37/CS hydrogel. The scale bar indicates 500 nm; d. In vitro release of LL37 from the LL-37/CS hydrogel (plotted as μg cumulative release vs. time) (mean ± SD, n = 3)

Full size image

Cytotoxicity, immunoregulation and antimicrobial properties

Incubation of the NIH3T3 cells with either LL-37 or LL-37/CS hydrogels for 48 h did not decrease cell count (Fig. 2a-b). LPS-induced TNF-α release from macrophages was decreased by free LL-37 peptide as well as LL-37/CS hydrogel, with maximum activity at 5 μg/ml in hydrogel (Fig. 2c). Treatment with CS hydrogel alone did not affect TNF-α release. LL-37 peptide (5 μg/ml) and LL-37/CS hydrogel (containing 5 μg/ml LL-37) decreased the number of Staphylococcus aureus colony growth by approximately 40 and 25%, respectively (Fig. 2d). CS hydrogel treatment alone showed no significant antimicrobial activity.

Fig. 2
figure 2

Activity of LL-37/CS in vitro. a-b. NIH3T3 cell viability was evaluated by the CCK-8 assay for 24 h and 48 h. NIH3T3 cells were treated with CS, LL-37 and LL-37/CS or PBS (control) (n = 6). There was no significant difference between the groups. c. Inhibition of TNF-α expression in RAW264.7 cells. Controls are cells without any addition. d. The antimicrobial results are given as the inhibition zones of bacteria relative to the control among the five groups. *P < 0.05 and **P < 0.01 compared with LPS group

Full size image

LL-37/CS hydrogels accelerate deep tissue injury wound healing

The largest wound closure was identified in the mice that received treatment with LL-37/CS hydrogels (Fig. 3a-b). The wound areas of control, CS, LL-37 and LL-37/CS groups were reduced to 33.05% ± 0.59, 38.52% ± 0.53, 79.78% ± 0.13 and 8.96% ± 0.58% at 21 days, respectively. The wound closure by LL-37/CS hydrogels was significant different in comparison to all other treatment groups for the vast majority of time points. Notably, the LL-37/CS group showed a wound area rate of 84.24% ± 0.25, 56.22% ± 3.91, 48.12% ± 0.28 and 20.14% ± 0.21% after 11, 13, 15 and 17 days, respectively, significantly higher than that of the other groups. On days 15 and 21, mice treated with LL-37/CS hydrogel displayed characteristics of rapid and effective wound healing in comparison to the control group. It was clear that in the LL-37/CS hydrogel treatment group, the epidermal and subepidermal layers were well defined and organized (Fig. 3c-e). At 2 weeks, there were fewer inflammatory cells and the new epidermis was formed to a greater extent in the LL-37 group and LL-37/CS group. The epithelial thickness in the control, LL-37, CS and LL-37/CS groups were 35.43 ± 1.80, 42.90 ± 2.25, 35.03 ± 0.76 and 53.98 ± 2.61 μm, respectively. The numbers of blood capillaries per field in the same four groups were 7.33 ± 1.15, 16 ± 1, 9.33 ± 0.58 and 19.33 ± 0.58, respectively. At 3 weeks, the wound surfaces treated by LL-37/CS were much smoother and the new tissue was more full-grown. The numbers of blood capillaries per field in the control, LL-37, CS and LL-37/CS groups were 13.33 ± 0.58, 26 ± 1.73, 16.33 ± 0.58 and 29.33 ± 0.58, respectively. The wound regions in the LL-37 and LL-37/CS groups had significantly more blood capillaries than that of control group (P < 0.01).

Fig. 3
figure 3

LL-37/CS accelerates wound healing. a. Representative images of wounds of four tested groups, ruler units in mm. b. The results are expressed as the percentage of the initial wound on days 3, 5, 7, 9, 11, 13, 15, 19, and 21. Statistical significance compared with control group (mean ± SD; n = 3). c. LL-37/CS facilitated an increase in the density of new capillaries and re-epithelialization of deep tissue injury. Wound sections (n = 3) were stained with hematoxylin and eosin (H&E). Representative sections are presented for all four groups on days 14 and 21 after application of treatment (× 10 and × 20, mean ± SD; n = 3). *P < 0.05, **P < 0.01 and ***P < 0.001 compared with control group

Full size image

LL-37/CS hydrogels upregulate VEGF-A, TGF-β1 and HIF-1α and downregulate TNF-α and IL-6 expression

qRT-PCR revealed significantly higher expression of TGF-β1, VEGF-A and HIF-1α in the LL-37/CS hydrogel-treated group than in the control group on day 14 (Fig. 4a-c, P < 0.0001). However, there was no detectable difference in the mRNA expression of these genes between the untreated and CS hydrogel-treated group. Higher VEGF-A and HIF-1α expression was also observed in mice receiving free LL-37 in comparison with the control. IL-6 and TNF-α expression was lower on days 14 in the LL-37/CS hydrogel and LL-37 peptide-treated groups than that in control group (Fig. 4d-e, P < 0.001). No significant differences were observed between control and CS hydrogel-treated groups. IL-10 was increased in the LL-37/CS hydrogel-treated and LL-37 peptide-treated groups compared with control group (Fig. 4f, P < 0.01).

Fig. 4
figure 4

In vivo quantitative determination of mRNA expression in wound sites. a-f. TGF-β1, VEGF-A, HIF-1α, IL-6, TNF-α, and IL-10 expression at the mRNA level in deep tissue injury (mean ± SD; n = 3). The error bars indicate the standard deviation of the mean. *P < 0.05, ** P < 0.01, ***P < 0.001 and ****P < 0.0001 compared with control group.

Full size image

LL-37/CS hydrogel upregulates HIF-1α, TGF-β and VEGF-A expression

Western blotting showed that the relative intensity of HIF-1α in control, CS, LL-37 and LL-37/CS groups were 0.36 ± 0.03, 0.34 ± 0.03, 0.66 ± 0.03 and 0.98 ± 0.1, repectively (Fig. 5b). The relative intensity of TGF-β in the same four groups were 1 ± 0.02, 2.22 ± 0.1, 3.52 ± 0.03 and 4.32 ± 0.56, respectively (Fig. 5c). And the relative intensity of VEGF-A in the same four groups were 0.36 ± 0.03, 0.34 ± 0.03, 0.66 ± 0.03 and 0.978 ± 0.1, repectively (Fig. 5d). Notely, LL-37/CS hydrogel and LL-37 peptide treatments increased HIF-1α, TGF-β and VEGF-A proteins in comparison to the control group (P < 0.01).

Fig. 5
figure 5

Results of Western blotting. This figure shows the changes in the protein expression of HIF-1α, TGF-β and VEGF-A in wound tissue; β-actin was used as a loading control. a-d. The relative protein expression of HIF-1α, TGF-β1 and VEGF-A was calculated as integrated density values. The error bars indicate the standard deviation of the mean. *P < 0.05, **P < 0.01 and ***P < 0.001 compared with control group.

Full size image

Discussion

In this study, LL-37/CS hydrogels were injected subcutaneously into the wound site of deep tissue injuries. LL-37/CS hydrogels had an increased capacity to drive wound closure and to improve re-epithelialization by keratinocytes. In addition, the formulation and generation of LL-37/CS hydrogel used in the present study displayed excellent cytocompatibility and no cytotoxic effects in vitro (Fig. 2).

The pathological changes relating to symptoms of deep tissue injuries and pressure wounds were evident in control group and were observed to be resolved following treatment with LL-37/CS hydrogels (Fig. 3). Previous research has shown that ischemia-reperfusion injury can promote and aggravate deep tissue injuries and even result in limb gangrene or shedding [5, 31], suggesting that tissue hypoxia may play a prominent role in driving the complications associated with deep tissue injuries. Anti-inflammation and angiogenesis mechanisms were shown to be important factors in limiting damage to deep tissue muscle injuries [32, 33]; thus, targeting these fundamental mechanisms of wound healing may help to limit damage resulting from pressure wounds. TNF-α is the initiator of inflammatory responses in ischemia-reperfusion injury, resulting in the enhancement of antibody-dependent cell-mediated cytotoxicity, stimulation of cell degranulation and secretion of myeloperoxidases [34, 35]. IL-6 activates B-cells following its secretion by macrophages, lymphocytes and epithelial cells. IL-6 has also been shown to have dual functionality, either causing or inhibiting inflammation, depending on the chronicity of tissue trauma [36, 37]. In this study, tissue mRNA expression of the inflammatory factors IL-6 and TNF-α was determined by qRT-PCR, as shown in Fig. 4. In previous studies, it was found that LL-37 exerts a protective effect against inflammatory damage by inhibiting the activation of certain enzymes or activators of inflammatory factors [14, 38, 39], observations that are in keeping with our findings.

New blood vessel formation is also critical for tissue repair, as the provision of oxygen and nutrients to the wound site facilitates tissue regeneration [40]. VEGF is an endothelial-specific angiogenic factor that promotes endothelial cell proliferation, migration, and lumen formation and increases vascular permeability [41]. In this study, we demonstrated that LL-37 accelerated wound healing rates and stimulated the production of VEGF-A within wound tissue (Fig. 4). These results are in keeping with the findings of previous studies, which also demonstrated that LL-37 induced VEGF-A in human keratinocytes.

In this study, we show that the mechanism of LL-37 induction of VEGF-A production is regulated by HIF-1α. HIF-1α is an important nuclear transcriptional regulator involved in cellular adaptation to hypoxia and has roles in regulating hypoxic tissue angiogenesis, cell proliferation and cell survival [42]. Previous studies reported that HIF-1α upregulated VEGF expression and promoted angiogenesis, which suggests that it is vital in the rescue of tissue repair following ischemia-reperfusion-associated injuries. In this study, it was found that the expression of VEGF in the treated group was significantly higher than that in control group at day 14 after wounding. The data showed that HIF-1α had a positive correlation with VEGF protein expression, suggesting that HIF-1α is closely related to angiogenesis in deep tissue injuries (Figs. 4 and 5). TGF-β is a multifunctional cytokine that promotes angiogenesis after ischemia-reperfusion [43]. In our current work, the expression of TGF-β1 was detected in the different treatment groups by qRT-PCR on day 14 of wound healing. The results indicated that the mRNA expression of TGF-β within deep tissue injuries significantly increased after LL-37/CS hydrogel treatment. Therefore, LL-37/CS hydrogels may convey therapeutic action through the upregulation of pro-angiogenic growth factor expression, subsequently increasing blood supply while promoting the generation of granulation tissue and protecting against tissue matrix catabolism.

The local treatment of deep tissue injuries with LL-37/CS hydrogels shown in this investigation offers a promising therapy for deep tissue and pressure-associated injuries. It was previously suggested that LL-37 is involved in angiogenesis. Indeed, LL-37 has been shown to be associated with wound healing in chronic wounds, namely, diabetic foot ulcers. Our results showed that LL-37 hydrogels directly increased angiogenesis and pro-healing cytokine production in deep tissue injuries, suggesting that the outcomes from LL-37/CS hydrogel treatment in deep tissue injury healing may also be applicable to chronic nonhealing wounds or broader ischemic tissue injuries.

Conclusion

LL-37-loaded CS hydrogels were successfully fabricated and could improve wound healing in deep tissue pressure injuries. Our results showed that topically injected LL-37/CS hydrogels could enhance anti-inflammatory and pro-angiogenic cytokine production in wounds of deep tissue injuries, overcoming the chronic inflammation and poor microcirculation issues commonly observed in chronic wound environments. The LL-37/CS hydrogel could effectively deliver LL-37 peptide to the wound site and produce antimicrobial and pro-healing activity.