Good Health and Well-Being

Living Edition
| Editors: Walter Leal Filho, Tony Wall, Anabela Marisa Azul, Luciana Brandli, Pinar Gökcin Özuyar

Climate Change and Health

  • Dara V. GaevaEmail author
  • Galina M. Barinova
  • Eugene V. Krasnov
Living reference work entry
DOI: https://doi.org/10.1007/978-3-319-69627-0_46-1

Definition of the Subject

According to WHO Health is a state of complete physical, mental, and social well-being and not merely the absence of disease or infirmity (WHO 2018b).

As a result of global climate change, people in many regions of the globe are increasingly falling ill and even dying as a result of the indirect and direct impact of extreme events. Tropical cyclones, hurricanes, floods, droughts, heat and cold waves annually take many lives and promoting the spread of natural focal, transmissible diseases, exacerbation of chronic pulmonary, cardiovascular, and other diseases. Extreme climatic phenomena adversely affect not only the physical, but also the psychological state of the population, reduce economic efficiency, and cause political tensions and conflicts.

Introduction

People’s health is inextricably linked with many social and economic factors, the quality of air, water, food, as well as climate and weather conditions in various regions of the globe. In the context of...

This is a preview of subscription content, log in to check access.

References

  1. Andersen LK, Davis MDP (2016) Climate change and the epidemiology of selected tick-borne and mosquito-borne diseases: update from the International Society of Dermatology Climate Change Task Force. Int J Dermatol 56:252–259.  https://doi.org/10.1111/ijd.13438
  2. APLMA (2017) What is APLMA? http://aplma.org/who-we-are/what-is-aplma.html. Accessed 21 Sept 2018
  3. Babayeva IV, Doroshenko EM (2015) Opredeleniyeurovnyaserotonina v likvorepatsiyentov s kleshchevymentsefalitom. Sovremennyye dostizheniya molodykh uchonykh v meditsine: sbornik materialov II Respublikanskoy nauchno-prakticheskoy konferentsii s mezhdunarodnym uchastiyem. GrGMU, Grodno, pp 8–10Google Scholar
  4. Baker-Austin C, Trinanes J, Gonzalez-Escalona N, Martinez-Urtaza J (2017) Non-cholera vibrios: the microbial barometer of climate change. Trends Microbiol 25:76–84.  https://doi.org/10.1016/j.tim.2016.09.008
  5. Barinova G, Kokhanovskaya M (2015) Climate change monitoring on the basis of phytophenological observations in Kaliningrad region. Pollut Atmos.  https://doi.org/10.4267/pollution-atmospherique.5009. Accessed 1 Apr 2018
  6. Barinova GM et al (2015) Changes of South Baltic Region climate: agroecological challenges and responses. Springer, Berlin.  https://doi.org/10.1007/978-3-642-38670-1_17. Accessed 11 Apr 2018
  7. Bourque F, Willox AC (2014) Climate change: the next challenge for public mental health? Int Rev Psychiatry 26:415–422.  https://doi.org/10.3109/09540261.2014.925851
  8. Campbell LP et al (2015) Climate change influences on global distributions of dengue and chikungunya virus vectors. Philos Trans R Soc B Biol Sci 370(1665):20140135.  https://doi.org/10.1098/rstb.2014.0135
  9. D’Amato G et al (2015) Meteorological conditions, climate change, new emerging factors, and asthma and related allergic disorders. A statement of the World Allergy Organization. World Allergy Organ J 8:25. https://www.ncbi.nlm.nih.gov/pubmed/26207160. Accessed 8 Apr 2018
  10. European Centre for Disease Prevention and Control (2017) West Nile fever cases by affected areas in Europe and the Mediterranean, 2016 transmission season. European Centre for Disease Prevention and Control. © European Centre for Disease Prevention and Control (ECDC) 2019 https://ecdc.europa.eu/en/publications-data/west-nile-fever-cases-affected-areas-europe-and-mediterranean-2016-transmission. Accessed 5 Apr 2018
  11. Every-Palmer S et al (2015) Climate change and psychiatry. Aust N Z J Psychiatry.  https://doi.org/10.1177/0004867415615946. Accessed 14 Apr 2018
  12. Fann N et al (2014) The geographic distribution and economic value of climate change-related ozone health impacts in the United States in 2030. J Air Waste Manag Assoc 65(5):570–580Google Scholar
  13. Ford JD (2014) Adapting to the effects of climate change on Inuit health. Am J Public Health 104:e9–e17.  https://doi.org/10.2105/AJPH.2013.301724. Accessed 30 Mar 2018
  14. Galway LP et al (2015) Hydroclimatic variables and acute gastro-intestinal illness in British Columbia, Canada: a time series analysis. Water Resour Res 51:885–895.  https://doi.org/10.1002/2014wr015519
  15. Gentry J et al (2016) Predictive mapping of transmission risk of a soil-transmitted helminth across east Africa: findings from community prevalence surveys. J Public Health Dev Countries 2:150–161Google Scholar
  16. Gifford E, Gifford R (2016) The largely unacknowledged impact of climate change on mental health. Bull At Sci 72:292–297.  https://doi.org/10.1080/00963402.2016.1216505. Accessed 17 Apr 2018
  17. GLEAN (2018) Leptospirosis. https://sites.google.com/site/gleanlepto/home. Accessed 19 Sept 2018
  18. Gordon CA (2016) The increase of exotic zoonotic helminth infections: the impact of urbanization, climate change and globalization. Adv Parasitol 91:311–397Google Scholar
  19. Grigoŕyeva EA (2014) Volnytepla v Khabarovskeizdorov’yenaseleniya. Izv Samarskogonauchnogotsentra Rossiyskoy Akad Nauk 5(2):843–846Google Scholar
  20. Hajat S et al (2014) Climate change effects on human health: projections of temperature-related mortality for the UK during the 2020s, 2050s and 2080s. J Epidemiol Community Health 68:641–648.  https://doi.org/10.1136/jech-2013-202449
  21. Hay RJ, Johns NE, Williams HC et al (2014) The global burden of skin disease in 2010: an analysis of the prevalence and impact of skin conditions. J Investig Dermatol 134:1527–1534.  https://doi.org/10.1038/jid.2013.446
  22. IPCC (2007) Climate Change 2007: The Physical Science Basis. Contribution of Working Group I to the Fourth Assessment Report of the Intergovernmental Panel on Climate Change [Solomon, S., D. Qin M. Manning Z. Chen M. Marquis K.B. Averyt M. Tignor H.L. Miller (eds.)]. Cambridge University Press, Cambridge, United Kingdom and New York, NY, USA, 996 pp. https://www.ipcc.ch/site/assets/uploads/2018/05/ar4_wg1_full_report-1.pdf
  23. IPCC (2013) Fifth assessment report – climate change. https://www.ipcc.ch/report/ar5/wg1/. Accessed 10 Apr 2018
  24. Johnson RJ, Stenvinkel P, Jensen T et al (2016) Metabolic and kidney diseases in the setting of climate change, water shortage, and survival factors. J Am Soc Nephrol 27:2247–2256.  https://doi.org/10.1681/asn.2015121314
  25. Khan IA, Abbas F (2014) Managing dengue outbreak in Lahore, Pakistan: efficacy of government response and lessons for the future. J Health Manag 16(4):471–480Google Scholar
  26. Kokorin AO (2014) Izmeneniyeklimata: obzorPyatogootsenochnogodoklada MGEIK. Vsemirnyy fond dikoyprirody. Moskva, р 80Google Scholar
  27. Kraemer MU, Sinka ME, Duda KA et al (2015) The global distribution of the arbovirus vectors Aedesaegypti and Ae. albopictus. elife 4:e08347Google Scholar
  28. Kurup R et al (2017) Malaria trend and effect of rainfall and temperature within Regions 7 and 8, Guyana. http://www.dipterajournal.com/pdf/2017/vol4issue6/PartA/4-4-5-421.pdf
  29. Malkhazova SM (2017) Novyye I vozvrashchayushchiyesya infektsii v Rossii: mediko-geograficheskiy aspekt. Vestn Moskov Univ 5:24–32Google Scholar
  30. Meehl GA, Stocker TF, Collins WD, Friedlingstein P, Gaye AT, Gregory JM, Kitoh A, Knutti R, Murphy JM, Noda A, Raper SCB, Watterson IG, Weaver AJ, Zhao Z.-C. (2007) Global Climate Projections. Figure 10.8. In: Climate Change 2007: The Physical Science Basis. Contribution of Working Group I to the Fourth Assessment Report of the Intergovernmental Panel on Climate Change [Solomon, S., D. Qin, M. Manning, Z. Chen, M. Marquis, K.B. Averyt, M. Tignor and H.L. Miller (eds.)]. Cambridge University Press, Cambridge, United Kingdom and New York, NY, USA. https://archive.ipcc.ch/report/graphics/index.php?t=Assessment%20Reports&r=AR4%20-%20WG1&f=Chapter%2010
  31. MERIT (2018) Meningitis environmental risk information technologies (MERIT) project. http://merit.hc-foundation.org/aboutMERIT2012.html. Accessed 10 Sept 2018
  32. Morse S (2001) Factors in the emergence of infections disease. Plagues and politics. Palgrave Macmillan, London, pp 8–26Google Scholar
  33. Newton JN et al (2015) Changes in health in England, with analysis by English regions and areas of deprivation, 1990–2013: a systematic analysis for the Global Burden of Disease Study 2013. Lancet. https://www.sciencedirect.com/science/article/pii/S0140673615001956. Accessed 30 Apr 2018
  34. Ogden NH et al (2014) Estimated effects of projected climate change on the basic reproductive number of the Lyme disease vector Ixodesscapularis. Environ Health Perspect 122(6):631Google Scholar
  35. Parkinson AJ et al (2014) Climate change and infectious diseases in the Arctic: establishment of a circumpolar working group. Int J Circumpolar Health 73:25163.  https://doi.org/10.3402/ijch.v73.25163
  36. Patterson J et al (2016) Dengue, Zika and chikungunya: emerging arboviruses in the New World. Western Journal of Emergency Medicine 17(6):671Google Scholar
  37. Patz JA et al (2014) Climate change. JAMA 312:1565.  https://doi.org/10.1001/jama.2014.13186
  38. Paz S (2015) Climate change impacts on West Nile virus transmission in a global context. Philos Trans R Soc B Biol Sci 370:20130561.  https://doi.org/10.1098/rstb.2013.0561
  39. Prist PR et al (2017) Climate change and sugarcane expansion increase Hantavirus infection risk. PLoS Negl Trop Dis.  https://doi.org/10.1371/journal.pntd.0005705
  40. Rochlin I et al (2013) Climate change and range expansion of the Asian Tiger mosquito (Aedesalbopictus) in Northeastern USA: implications for public health practitioners. PLoS One.  https://doi.org/10.1371/journal.pone.0060874
  41. Sergeyev AM et al (2015) KleshchevoyentsefalitiLaym-borrelioz v RespublikeKareliya (sovremennyyeaspektyklinikiiepidemiologii). UchenyyezapiskiPetrozavodskogogosudarstvennogouniversiteta. Biol Nauki 4(149):34–36Google Scholar
  42. Singh M et al (2016) Climate change, health and future well-being in South Asia. Climate change and human health scenario in South and Southeast Asia advances in Asian human-environmental research. pp 11–27.  https://doi.org/10.1007/978-3-319-23684-1_2
  43. TDR (2017) Climate change research findings provided for policy discussions in Africa. http://www.who.int/tdr/news/2017/climate-change-research-findings-policy-africa/en/. Accessed 10 Sept 2018
  44. Tian H et al (2017) Interannual cycles of Hantaan virus outbreaks at the human–animal interface in Central China are controlled by temperature and rainfall. Proc Natl Acad Sci 114:8041–8046.  https://doi.org/10.1073/pnas.1701777114
  45. Tissera H et al (2016) Sustainable dengue prevention and control through a comprehensive integrated approach: the Sri Lankan perspective. WHO South-East Asia J Public Health 5(2):106Google Scholar
  46. WHO (2012) Atlas of health and climate. http://www.who.int/globalchange/publications/atlas/report/en/. Accessed 17 Sept 2018
  47. WHO (2016) Eliminating malaria. In: © World Health Organization 2016. https://apps.who.int/iris/bitstream/handle/10665/205565/WHO_HTM_GMP_2016.3_eng.pdf?sequence=1&isAllowed=y
  48. WHO (2017a) Hepatitis A. http://www.who.int/ru/news-room/fact-sheets/detail/hepatitis-a. Accessed 15 Sept 2018
  49. WHO (2017b) Vector-borne diseases 2017. http://www.who.int/news-room/fact-sheets/detail/vector-borne-diseases. Accessed 28 Apr 2018
  50. WHO (2017c) WHO publishes list of top emerging diseases likely to cause major epidemics. In: World Health Organization. http://www.who.int/medicines/ebola-treatment/WHO-list-of-top-emerging-diseases/en/. http://www.who.int/medicines/ebola-treatment/WHO-list-of-top-emerging-diseases/en/. Accessed 12 Apr 2018
  51. WHO (2018a) Q&A on the E-2020 initiative and malaria elimination http://www.who.int/malaria/media/e-2020-initiative-qa/en/. Accessed 12 Sept 2018
  52. WHO (2018b) What is the WHO definition of health? http://www.who.int/suggestions/faq/en/. Accessed 29 Apr 2018
  53. Willox AC et al (2014) Examining relationships between climate change and mental health in the Circumpolar North. Reg Environ Chang 15:169–182.  https://doi.org/10.1007/s10113-014-0630-z. Accessed 30 Apr 2018

Copyright information

© Springer Nature Switzerland AG 2019

Authors and Affiliations

  • Dara V. Gaeva
    • 1
    Email author
  • Galina M. Barinova
    • 2
  • Eugene V. Krasnov
    • 2
  1. 1.Service for Organization of Scientific Research ActivityImmanuel Kant Baltic Federal UniversityKaliningradRussia
  2. 2.Institute of Environmental Management, Urban Development and Spatial Planning (IEMUD&SP)Immanuel Kant Baltic Federal UniversityKaliningradRussia

Section editors and affiliations

  • Meherun Ahmed
    • 1
  1. 1.Asian University for WomenChittagongBangladesh