Skip to main content
SpringerLink
Log in

Insights to Sequence Information of Polyphenol Oxidase Enzyme from Different Source Organisms

  • Published:
Applied Biochemistry and Biotechnology Aims and scope Submit manuscript

Abstract

Polyphenol oxidases (PPOs) are widely distributed enzymes among animals, plants, bacteria, and fungi. PPOs often have significant role in many biologically essential functions including pigmentation, sclerotization, primary immune response, and host defense mechanisms. In the present study, forty-seven full-length amino acid sequences of PPO from bacteria, fungi, and plants were collected and subjected to multiple sequence alignment (MSA), domain identification, and phylogenetic tree construction. MSA revealed that six histidine, two phenylalanine, two arginine, and two aspartic acid residues were highly conserved in all the analyzed species, while a single cysteine residue was conserved in all the plant and fungal PPOs. Two major sequence clusters were constructed by phylogenetic analysis. One cluster was of the plant origin, whereas the other one was of the fungal and bacterial origin. Motif GGGMMGDVPTANDPIFWLHHCNVDRLWAVWQ was found in all the species of bacterial and fungus sources. In addition, seven new motifs which were unique for their group were also identified.

This is a preview of subscription content, log in via an institution to check access.

Access this article

Log in via an institution

Price excludes VAT (USA)
Tax calculation will be finalised during checkout.

Instant access to the full article PDF.

Institutional subscriptions

Fig. 1
Fig. 2
Fig. 3
Fig. 4

Similar content being viewed by others

References

  1. Mayer, A. M. (2006). Phytochemistry, 67, 2318–2331.

    Article  CAS  Google Scholar 

  2. Mason, H. (1955). Adv Enzymol, 16, 105–184.

    CAS  Google Scholar 

  3. Umit, U. M. (2007). Food Chem, 100, 909–913.

    Article  Google Scholar 

  4. Wichers, H. J., Recourt, K., Hendriks, M., Ebbelaar, C. F. M., Biancone, G., & Hoeberichts, F. A. (2003). Appl Microbiol Biotechnol, 61, 336–341.

    CAS  Google Scholar 

  5. Bailey, T. L., & Elkan, C. (1995). Mach Learn, 21(1–2), 51–80.

    Google Scholar 

  6. Bailey, T. L., & Gribskov, M. (1998). Bioinformatics, 14(1), 48–54.

    Article  CAS  Google Scholar 

  7. Tamura, K., Dudley, J., Nei, M., & Kumar, S. (2007). Mol Biol Evol, 24, 1596–1599.

    Article  CAS  Google Scholar 

  8. Marusek, C. M., Trobaugh, N. M., Flurkey, W. H., & Inlow, J. K. (2006). J Inorg Biochem, 100, 108–123.

    Article  CAS  Google Scholar 

  9. Garcia-Borron, J. C., & Solano, F. (2002). Pigment Cell Res, 15, 162–173.

    Article  CAS  Google Scholar 

  10. van Gelder, C. W. G., Flurkey, W. H., & Wichers, H. J. (1997). Phytochemistry, 45, 1309–1323.

    Article  Google Scholar 

  11. Gerdemann, C., Eicken, C., & Krebs, B. (2002). Acc Chem Res, 35, 183–191.

    Article  CAS  Google Scholar 

  12. Klabunde, T., Eicken, C., Sacchettini, J. C., & Krebs, B. (1998). Nat Struct Biol, 5, 1084–1090.

    Article  CAS  Google Scholar 

  13. Eickena, C., Krebs, B., & Sacchettini, J. C. (1999). Curr Opin Struct Biol, 9, 677–683.

    Article  Google Scholar 

Download references

Author information

Authors and Affiliations

  1. Department of Biotechnology, Deen Dayal Upadhyay Gorakhpur University, Gorakhpur, India

    Neha Malviya, Sanjeev Kumar Diwakar & Sarad Kumar Mishra

  2. Department of Botany, Atarra P.G. College, Bundelkhand University, Bundelkhand, India

    Mugdha Srivastava

Authors
  1. Neha Malviya
    View author publications

    You can also search for this author in PubMed Google Scholar

  2. Mugdha Srivastava
    View author publications

    You can also search for this author in PubMed Google Scholar

  3. Sanjeev Kumar Diwakar
    View author publications

    You can also search for this author in PubMed Google Scholar

  4. Sarad Kumar Mishra
    View author publications

    You can also search for this author in PubMed Google Scholar

Corresponding author

Correspondence to Neha Malviya.

Electronic Supplementary Material

Below is the link to the electronic supplementary material.

Supplement A (DOC 41 kb)

Supplement B (DOC 69 kb)

Supplement C (DOC 106 kb)

Rights and permissions

Reprints and permissions

About this article

Cite this article

Malviya, N., Srivastava, M., Diwakar, S.K. et al. Insights to Sequence Information of Polyphenol Oxidase Enzyme from Different Source Organisms. Appl Biochem Biotechnol 165, 397–405 (2011). https://doi.org/10.1007/s12010-011-9259-2

Download citation

  • Received:

  • Accepted:

  • Published:

  • Issue Date:

  • DOI: https://doi.org/10.1007/s12010-011-9259-2

Keywords

Search

Navigation