Abstract
FKBP, an 11.8 kD intracellular protein that binds the immunosuppressants FK506 (K d=0.4 nM) and rapamycin (K d=0.2 nM) with high affinity, was purified to homogeneity from calf thymus. The complete amino acid sequence has been determined by automated Edman degradation of the intact molecule and overlapping fragments generated by proteolytic and chemical cleavage. The analysis revealed a 107 amino acid peptide chain with the following sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE. The molecular weight, calculated from the amino sequence to be 11,778 D, was confirmed by electrospray ionization mass spectrometry. Thus, naturally isolated bovine FKBP does not appear to have any residues modified by glycosylation, phosphorylation, or other post-translational derivatization processes. Bovine FKBP has only three amino acid residues that differ from human FKBP, whose sequence was elucidated by cloning and sequencing complementary DNA (Standaertet al., 1990). The protein has a substantial number of hydrophilic peptide segments with prevalent β-strand type of chain fold. Understanding the biological function of FKBP and other members of the immunophilin class and their respective complexes with immunosuppressive drugs may provide insights into cytoplasmic signalling mechanisms, protein folding and translocation, and other cellular processes.
This is a preview of subscription content, log in via an institution to check access.
Similar content being viewed by others
References
Albers, M. W., Walsh, C. T., and Schreiber, S. L. (1990).J. Org. Chem. 55, 4984–4986.
Bierer, B. E., Mattila, P. S., Standaert, R. F., Herzenberg, L. A., Burakoff, S. J., Crabtree, G., and Schreiber, S. L. (1990a).Proc. Natl. Acad. Sci. USA 87, 9231–9235.
Bierer, B. E., Somers, P. K., Wandless, T. J., Burakoff, S. J., and Schreiber, S. L. (1990b).Science 250, 556–558.
Blum, H., Beier, H., and Gross, H. J. (1987).Electrophoresis 8, 93–99.
Chou, P. Y., and Fasman, G. D. (1974).Biochemistry 13, 222–248.
Chou, P. Y., and Fasman, G. D. (1979).Biophys. J. 26, 367–384.
Dumont, F. J., Melino, M. R., Staruch, M. J., Koprak, S. L., Fisher, P. A., and Sigal, N. H. (1990).J. Immunology 144, 1418–1424.
Fasman, G. D. (1989). InHandbook of Biochemistry and Molecular Biology (Fasman, G. D., ed.), CRC Press, Boca Raton, Florida, pp. 79–85.
Guo, D., Mant, C. T., Taneja, A. K., Parker, J. M. R., and Hodges, R. S. (1986).J. Chromatog. 359, 499–518.
Harding, M. W., Galat, A., Uehling, D. E., and Schreiber, S. L. (1989).Nature 341, 758–760.
Hinrichs, D. J., Wegmann, K. W., and Peters, B. A. (1983).Cell Immunol. 77, 202–209.
Kino, T., Hatanaka, H., Hashimoto, M., Nishiyama, M., Goto, T., Okuhara, M., Kohsaka, M., Aoki, H., and Imanaka, H. (1987).J. Antib. 40, 1249–1255.
Kino, T., Hatanaka, H., Miyata, S., Inamura, N., Nishiyama, M., Yajima, J., Goto, T., Okuhara, M., Kohsaka, M., Aoki, H., and Ochiai, J. (1987).J. Antib. 40, 1256–1265.
Kyte, J., and Doolittle, R. F. (1982).J. Molec. Biol. 157, 105–132.
Lapanje, S., and Poklar, N. (1989).Biophys. Chem. 34, 155–162.
Maki, N., Sekiguchi, F., Nishimaki, J., Miwa, K., Hayano, T., Takahashi, N., and Suzuki, M. (1990).Proc. Natl. Acad. Sci. U.S.A. 87, 5440–5443.
Mant, C. T., Zhou, N. E., and Hodges, R. S. (1989).J. Chromatog. 476, 363–375.
Metcalfe, S. M., and Richards, F. M. (1990).Transplanation 49, 798–802.
Monaco, H. L., Zanotti, G., Spadon, P., Bolognesi, M., Sawyer, L., and Eliopoulos, E. E. (1987).J. Molec. Biol. 197, 695–706.
Nussenblatt, R. B., Salinas-Carmona, M., Waksman, B. H., and Gery, I. (1983).Int. Arch. Allergy Appl. Immunol. 70, 289–294.
Papiz, M. Z., Sawyer, L., Eliopoulos, E. E., North, A. C. T., Findley, J. B. C., Sivaprasadarao, R., Jones, T. A., Newcomer, M. E., and Kraulis, P. J. (1986).Nature 324, 383–385.
Siekerka, J. J., Hung, S. H. Y., Poe, M., Lin, S. C., and Sigal, N. H. (1989).Nature 341, 755–757.
Smith, R. D., Loo, J. A., Barinaga, C. J., Edmonds, C. G., and Udseth, H. R. (1990).J. Am. Soc. Mass Spectr. 1, 53–65.
Standaert, R. F., Galat, A., Verdine, G. L., and Schreiber, S. L. (1990).Nature 346, 671–674.
Starzl, T., Fung, J., Venkataramman, R., Todo, S., Demetris, A. J., and Jain, A. (1989).The Lancet 1000.
Stiller, C. R., Dupre, J., Gent, M., Jenner, M. R., Keown, P. A., Laupacis, A., Martell, R., Rodger, N. W., Graffenried, B. V., and Wolfe, B. M. J. (1984).Science 223, 1362–1367.
Stone, K. L., LoPresti, M. B., Williams, N. D., Crawford, J. M., DeAngelis, R., and Williams, K. R. (1989). InTechniques in Protein Chemistry (Hugli, T., ed.), Academic Press, San Diego, pp. 377–391.
Tanaka, H., Kuroda, A., Marusawa, H., Hatanaka, H., Kino, T., Goto, T., Hashimoto, M., and Taga, T. (1987).J. Am. Chem. Soc. 109, 5031–5033.
Thomson, A. W. (1989).Immunol. Today 10, 6–9.
Tropschug, M., Barthelmess, I. B., and Neupert, W. (1989).Nature 342, 953–955.
Tropschug, M., Wachter, E., Mayer, S., Schonbrunner, E. R., and Schmid, F. X. (1990).Nature 346, 674–677.
Yoshimura, N., Matsui, S., Hamashima, T., and Oka, T. (1989).Transplantation 47, 351–364.
Author information
Authors and Affiliations
Rights and permissions
About this article
Cite this article
Lane, W.S., Galat, A., Harding, M.W. et al. Complete amino acid sequence of the FK506 and rapamycin binding protein, FKBP, isolated from calf thymus. J Protein Chem 10, 151–160 (1991). https://doi.org/10.1007/BF01024778
Received:
Published:
Issue Date:
DOI: https://doi.org/10.1007/BF01024778