Skip to main content
Log in

Zinc-Binding Peptides from Protein of Cicer arietinum

  • Published:
Chemistry of Natural Compounds Aims and scope

A zinc-binding peptide was obtained from the albumin fraction of chickpea Cicer arietinum by separating Zn2+ using immobilizing metal-affinity chromatography followed by isolation using reversed-phase HPLC. GC-MS results showed that the molecular mass of the peptide was 3896 Da and that the peptide consisted of the 34 amino-acid residues IVQQPDGEKSERKIENENGEGEDGEQDLTVYDFE. This peptide was determined to be a fragment of a protein with a zinc finger.

This is a preview of subscription content, log in via an institution to check access.

Access this article

Subscribe and save

Springer+
from $39.99 /Month
  • Starting from 10 chapters or articles per month
  • Access and download chapters and articles from more than 300k books and 2,500 journals
  • Cancel anytime
View plans

Buy Now

Price excludes VAT (USA)
Tax calculation will be finalised during checkout.

Instant access to the full article PDF.

Similar content being viewed by others

References

  1. A. E. Al-Snafi, IOSR J. Pharm., 6 (3), 29 (2016).

  2. A. Yili, Q. L. Ma, Q. Y. Lv, Y. H. Gao, B. Zhao, O. N. Veshkurova, Sh. I. Salikhov, and H. A. Aisa, Chem. Nat. Compd., 48, 643 (2012).

    Article  CAS  Google Scholar 

  3. M. Yust, M. C. Millan-Linares, J. M. Alcaide-Hidalgo, F. Millan, and J. Pedroche, J. Sci. Food Agric., 92 (9), 1994 (2012).

    Article  CAS  Google Scholar 

  4. S. Kumar, V. Kapoor, K. Gill, K. Singh, I. Xess, S. N. Das, and Sh. Dey, BioMed Res. Int., 2014, 387203 (2014).

  5. A. Yili, M. Q. Ling, Zh. Bo, A. S. Asrorov, Yu. I. Oshchepkova, Sh. I. Salikhov, and H. A. Aisa, Chem. Nat. Compd., 47, 959 (2012).

    Article  CAS  Google Scholar 

  6. D. Bhowmik, Chiranjib, and K. P. Sampath Kumar, Int. J. Pharm. Biomed. Sci., 1 (1), 5 (2010).

  7. L. M. Plum, L. Rink, and H. Haase, Int. J. Environ. Res. Public Health, 7 (4), 1342 (2010).

    Article  CAS  Google Scholar 

  8. C. Megias, J. Pedroche, M. Yust, J Giro-Calle, M. Alaiz, F. Millan, and J. Vioque, J. Agric. Food Chem., 55 (10), 3949 (2007).

    Article  CAS  Google Scholar 

  9. L. M. Real Hernandez and E. G. Mejia, Compr. Rev. Food Sci. Food Saf., 18 (6), 1913 (2019).

    Article  CAS  Google Scholar 

  10. W. Liao, T. Lai, L. Chen, J. Fu, S. T. Sreenivasan, Zh. Yu, and J. Ren, J. Agric. Food Chem., 64 (7), 1509 (2016).

    Article  CAS  Google Scholar 

  11. Zh. Fang, L. Xu, Y. Lin, X. Cai, and Sh. Wang, Food Control, 98 (10), 24 (2019).

    Article  CAS  Google Scholar 

  12. K. Zhu, X. Wang, and X. Guo, J. Funct. Foods, 12 (1), 23 (2015).

    Article  Google Scholar 

  13. Ch. Wang, B. Li, and J. Ao, Food Chem., 134 (2), 1231 (2012).

    Article  CAS  Google Scholar 

  14. O. L. Tavano and V. A. Neves, Food Sci. Technol., 41 (7), 1244 (2008).

    CAS  Google Scholar 

  15. N. Xie, J. Huang, B. Li, J. Cheng, Zh. Wang, J. Yin, and X. Yan, Food Chem., 173 (4), 210 (2014).

    PubMed  Google Scholar 

  16. Ch. Wang, Ch. Wang, B. Li, and H. Li, Food Chem., 165 (12), 594 (2014).

    Article  CAS  Google Scholar 

  17. Q. Wang and Y. L. Xiong, J. Funct. Foods, 49 (10), 105 (2018).

    Article  CAS  Google Scholar 

  18. T. Fu, Sh. Zhang, Y. Shen, Y. Feng, Y. Jiang, Y. Zhang, M. Yu, and Ch. Wang, Eur. Food Res. Technol., 246 (11), 113 (2020).

    Article  CAS  Google Scholar 

  19. M. Ch. Udechukwu, B. Downey, and Ch. C. Udenigwe, Food Chem., 240, 1227 (2018).

    Article  CAS  Google Scholar 

  20. Z. Zhang, F. Zhou, X. Liu, and M. Zhao, Food Chem., 258, 269 (2018).

    Article  CAS  Google Scholar 

  21. A. Waili, Y. H. Gao, L. F. Zhang, Zh. F. Ziyavitdinov, V. V. Maksimov, A. Yili, and H. A. Aisa, Chem. Nat. Compd., 54, 1135 (2018).

    Article  CAS  Google Scholar 

Download references

Acknowledgment

The work was financed by the Chinese Foundation for Science and Technology Support of Xinjiang-Uyghur Autonomous Region of China (Grant No. 2020E02105), by the Presidential Initiative for International Stipends of the Chinese Academy of Sciences (Grant No. 2021VBA0012), the Stipend Program of the President, CAS-TWAS, PIFI, CAS Foundation Project No. 2019VBA0013, and the Tian-Shan Pine Project for 2020: Candidate Pool of Leading Talent for Scientific and Technical Innovation.

Author information

Authors and Affiliations

Authors

Corresponding author

Correspondence to A. Yili.

Additional information

Translated from Khimiya Prirodnykh Soedinenii, No. 1, January–February, 2022, pp. 78–81.

Rights and permissions

Reprints and permissions

About this article

Check for updates. Verify currency and authenticity via CrossMark

Cite this article

Mukhamedov, N., Mirzaakhmedov, S.Y., Gao, Y.H. et al. Zinc-Binding Peptides from Protein of Cicer arietinum. Chem Nat Compd 58, 86–89 (2022). https://doi.org/10.1007/s10600-022-03602-3

Download citation

  • Received:

  • Published:

  • Issue Date:

  • DOI: https://doi.org/10.1007/s10600-022-03602-3

Keywords