Skip to main content
SpringerLink
Log in

Amino acid sequence of ferredoxin II from the phototroph Rhodospirillum rubrum: Characteristics of a 7Fe ferredoxin

  • Regular Paper
  • Anoxygenic Photosynthesis
  • Published:
Photosynthesis Research Aims and scope Submit manuscript

Abstract

The complete sequence of amino acids of ferredoxin II (FdII) from Rhodospirillum rubrum was determined by repetitive Edman degradation using pyridylethylated-ferredoxin and oxidized, denatured ferredoxin. Peptides derived from trypsin, pepsin, Glu-C endoproteinase, Arg-C endoproteinase, tryptophan specific cleavage and partial acid hydrolysis and C-terminal sequence from carboxypeptidase digestion were used to construct the total sequence. RrFdII is a polypeptide of 104 amino acids having a calculated molecular weight of 11556 excluding the iron and sulfur atoms. The complete amino acid sequence was: PYVVTENCIKCKYQDCVEVCPVDCFYEGENFLVINPDECIDCGVCNPECPAEAIAGKWLEINRKFADLWPNITRKGPAL ADADDWKDKPDKTGLLSENPGKGTV. Sequence comparisons, EPR characteristics and iron analyses indicate that RrFdII has structural features in common with ferredoxins containing [3Fe-4S], [4Fe-4S] centers. Of 104 amino acids, 60 (58%) including all 9 cysteines, are found in identical locations in the 7Fe ferredoxin prototype, Azotobacter vinelandii FdI.

This is a preview of subscription content, log in via an institution to check access.

Access this article

Log in via an institution

Price excludes VAT (USA)
Tax calculation will be finalised during checkout.

Instant access to the full article PDF.

Institutional subscriptions

Similar content being viewed by others

References

  • Andrews PC and Dixon JE (1987) A procedure for the in situ alkylation of cystine residues on glass fiber prior to protein microsequence analysis. Anal Biochem 161: 524–528

    Google Scholar 

  • Bruschi M and Guerlesquin F (1988) Structure, function and evolution of ferredoxins. FEMS Microbiol Rev 54: 155–176

    Google Scholar 

  • Buchanan BB and Arnon DI (1970) Ferredoxins: Chemistry and function in photosynthesis, nitrogen fixation and fermentative metabolism. Adv Enzymol 33: 119–176

    Google Scholar 

  • Corker GA, Henkin BM and Sharpe SA (1979) The contribution of Rhodospirillum rubrum ferredoxin II to in vitro EPR signals and its role in electron transport. Photochem Photobiol 29: 141–146

    Google Scholar 

  • Donaldio S and Hutchinson CR (1991) Cloning and characterization of the Saccharopolyspora erythraea fdxA gene encoding ferredoxin. Gene 100: 231–235

    Google Scholar 

  • Duport C, Jouanneau Y and Vignais PM (1990) Nucleotide sequence of fdxA encoding a 7Fe ferredoxin of Rhodobacter capsulatus. Nucleic Acids Res 18: 4618

    Google Scholar 

  • Emptage MH, Kent TA, Huynh BH, Rawlings J, Orme Johnson WH and Munck E (1980) On the nature of the iron-sulfur centers in a ferredoxin from Azotobacter vinelandii. J Biol Chem 255: 1793–1796

    Google Scholar 

  • Ghosh D, Furey WJr, O'Donnell S and Stout CD (1981) Structure of a 7Fe ferredoxin from Azotobacter vinelandii. J Biol Chem 256: 4185–4192

    Google Scholar 

  • Hallenbeck PC, Jouanneau Y and Vignais PM (1982) Purification and molecular properties of a soluble ferredoxin from Rhodopseudomonas capsulata. Biochim Biophys Acta 681: 168–176

    Google Scholar 

  • Harvey AEJr, Smart JA and Amis ES (1955) Simultaneous spectroscoptic determination of iron (II) and total iron with 1,10-phenanthroline. Anal Chem 27: 26–29

    Google Scholar 

  • Hase T, Wakabayashi S, Matsubara H, Ohmori and Suzuki K (1978) Pseudomonas ovalis ferredoxin: Similarity to Azotobacter vinelandii and Chromatium ferredoxins. FEBS Lett 91: 315–319

    Google Scholar 

  • Huang HV, Bond MW, Hunkapiller MW and Hood LE (1983) Cleavage at tryptophanyl residues with dimethyl sulfoxide-hydrochloric acid and cyanogen bromide. Meth Enymol 91: 318–324

    Google Scholar 

  • Howard JB, Lorsback TW, Ghosh D, Melis K and Stout CD (1983) Structure of Azotobacter vinelandii 7 Fe ferredoxin. J Biol Chem 258: 508–522

    Google Scholar 

  • Inglis AS (1983) Cleavage at aspartic acid. Meth Enzymol 91: 324–332

    Google Scholar 

  • Jouanneau Y, Meyer C, Gaillard J and Vignais PM (1990) Purification and characterization of a 7Fe-ferredoxin from Rhodobacter capsulatus. Biochem Biophys Res Commun 171: 273–279

    Google Scholar 

  • Moreno-Vivian C, Hennecke S, Pühler A and Klipp W (1989) Open reading frame 5 (ORF5), encoding a ferredoxinlike protein, and nifQ are cotranscribed with nifE, nifN and ORF4 in Rhodobacter capsulatus. J Bacteriol 171: 2591–2598

    Google Scholar 

  • Morgan TV, Lundell DJ and Burgess BK (1988) Azotobacter vinelandii ferredoxin I: Cloning, sequencing, and mutant analysis. J Biol Chem 263: 1370–1375

    Google Scholar 

  • Mortenson LE, Valentine RC and Carnahan JE (1962) An electron transport factor from Clostridium pasteurianum. Biochem Biophys Res Commun 7: 448–452

    Google Scholar 

  • Ormerod JG, Ormerod KS and Gest H (1961) Light-dependent utilzation of organic compounds and photoreduction of molecular hydrogen by photosynthetic bacteria: relationships with nitrogen metabolism. Arch Biochem Biophys 94: 449–463

    Google Scholar 

  • Saeki K, Suetsugu Y, Yao Y, Horio T, Marrs BL and Matsubara H (1990) Two distinct ferredoxins from Rhodobacter capsulatus: Complete amino acid sequences and molecular evolution. J Biochem (Tokyo) 108: 474–482

    Google Scholar 

  • Saeki K, Wakabayashi S, Zumft WG and Matsubara H (1988) Pseudomonas stutzeri ferredoxin: Close similarity to Azotobacter vinelandii and Pseudomonas ovalis ferredoxins. J Biochem (Tokyo) 104: 242–246

    Google Scholar 

  • Saeki K, Suetsugu K, Miyatake Y, Young DA, Marrs BL and Matsubara H (1991) Genetic Analysis of functional Differences among distinct ferredoxins from Rhodobacter capsulatus. J Biol Chem 266: 12889–12895.

    Google Scholar 

  • Schatt E, Jouanneau Y and Vignais (1989) Molecular cloning and sequence analysis of the structural gene of ferredoxin I from the photosynthetic bacterium Rhodobacter capsulatus. J Bacteriol 171: 6218–6226

    Google Scholar 

  • Shanmugam KT, Buchanan BB and Arnon DI (1972) Ferredoxin in light- and dark-grown photosynthetic cells with special emphasis on Rhodospirillum rubrum. Biochim Biophys Acta 256: 477–486

    Google Scholar 

  • Shanmugam KT and Arnon DI (1972) Effect of ferredoxin on bacterial phosphorylation. Biochim Biophys Acta 256: 487–497

    Google Scholar 

  • Stephens PJ, Morgan TV, Devlin F, Penner-Hahn JE, Hodgson KO, Scott RA, Stout CD and Burgess BK (1985) [4Fe-4S]-clusterdepleted Azotobacter vinelandii ferredoxin I: A new 3Fe iron-sulfur protein. Proc Natl Acad Sci USA 82: 5661–5665

    Google Scholar 

  • Stone KL and Williams KR (1993) Enzymatic digestion of proteins and HPLC peptide isolation. In: Matsudaira P (ed) A Practical Guide to Protein and Peptide Purification for Microsequensing, 2nd Ed, pp 54–59. Academic Press, San Diego

    Google Scholar 

  • Stout HG, Turley S, Sieker LC and Jensen LH (1988) Structure of ferredoxin I from Azotobacter vinelandii. Proc Natl Acad Sci USA 85: 1020–1022.

    Google Scholar 

  • Tagawa K and Arnon DI (1962) Ferredoxins as electron carriers in photosynthesis and in the biological production and consumption of hydrogen gas. Nature 195: 537–543.

    Google Scholar 

  • Tarr GE (1986) Methods of protein microcharacterization. Shively JE (ed), pp 167–189, Humana Press. Clifton, NJ

    Google Scholar 

  • Trower MK, Marshall JE, Doleman MS, Emptage MH and Sariaslani FS (1990) Primary structure of a 7Fe ferrdoxin from Streptomyces griseus. Biochim Biophys Acta 1037: 290–296

    Google Scholar 

  • Vanoni MA, Edmondson DE, Zanetti G and Curti B (1992) Characterization of the flavins and the iron-sulfur centers on glutamate synthase for Azosprillum brasilense by absorption, circular dichroism, and electron paramagnetic resonance spectroscopies. Biochemistry 31: 4612–4622

    Google Scholar 

  • vonSternberg R and Yoch DC (1993) Molecular cloning and sequencing of the ferredoxin I fdxN gene of the photosynthetic bacterium Rhodospirillum ruburm. Biochim Biophys Acta 1144: 435–438

    Google Scholar 

  • Wang SP, Kang PJ, Chen YP and Ely B (1995) Synthesis of the Caulobacter ferredoxin protein FdxA is cell cycle controlled. J Bacteriol 177: 2901–2907

    Google Scholar 

  • Yakunin AF and Gogotov IN (1983) Properties and regulation of synthesis of two ferredoxins from Rhodopseudomonas capsulata. Biochim Biophys Acta 725: 298–308

    Google Scholar 

  • Yoch DC and Arnon DI (1975) Comparison of two ferredoxins from Rhodospirillum rubrum as electron carriers for the native nitrogenase. J Bacteriol 121: 743–745

    Google Scholar 

  • Yoch DC, Arnon DI and Sweeny WV (1975) Characterization of two soluble ferredoxins as distinct from bound iron-sulfur proteins in the photosynthetic bacterium Rhodospirillum rubrum. J Biol Chem 250: 8330–8336

    Google Scholar 

  • Yuen SW, Chui AH, Wilson KJ and Yuan PM (1989) Microanalysis of SDS-PAGE electroblotted proteins. Biotechnique 7: 74–82

    Google Scholar 

Download references

Author information

Authors and Affiliations

  1. Department of Chemistry and Biochemistry, University of South Carolina, 29208, Columbia, South Carolina, USA

    Yoshinori Ishikawa

  2. Department of Biological Sciences, University of South Carolina, 29208, Columbia, South Carolina, USA

    Duane C. Yoch

Authors
  1. Yoshinori Ishikawa
    View author publications

    You can also search for this author in PubMed Google Scholar

  2. Duane C. Yoch
    View author publications

    You can also search for this author in PubMed Google Scholar

Additional information

The protein sequence data reported in this paper will appear in the SWISS-PROT database and EMBL Data Library under the accession number P80448.

Rights and permissions

Reprints and permissions

About this article

Cite this article

Ishikawa, Y., Yoch, D.C. Amino acid sequence of ferredoxin II from the phototroph Rhodospirillum rubrum: Characteristics of a 7Fe ferredoxin. Photosynth Res 46, 371–376 (1995). https://doi.org/10.1007/BF00020453

Download citation

  • Received:

  • Accepted:

  • Issue Date:

  • DOI: https://doi.org/10.1007/BF00020453

Key words

Search

Navigation