Immunogenetics

, Volume 60, Issue 3–4, pp 147–156 | Cite as

Evolution, expression and effectiveness in a cluster of novel bovine β-defensins

  • Paul Cormican
  • Kieran G. Meade
  • Sarah Cahalane
  • Fernando Narciandi
  • Aspinas Chapwanya
  • Andrew T. Lloyd
  • Cliona O’Farrelly
Original Paper

Abstract

The anti-microbial peptides β-defensins constitute a large family of innate immune effector molecules, conserved across a wide species range. In this paper, we describe a systematic search of the sequenced bovine genome to characterise this extensive gene family in Bos taurus, providing an insight into the pattern of conservation of β-defensin genes between species. We have sequenced a sub-set of these newly discovered bovine β-defensin genes and also report expression data for these genes across a range of tissues. We have synthesised the peptide product of one of these genes, bovine β-defensin 123, and found it to be a potent inhibitor of several pathogenic microbes, particularly Escherichia coli and Listeria monocytogenes.

Keywords

Anti-microbial peptide Defensin Bovine Bioinformatic 

Introduction

Defensin genes code for an extensive family of small cationic anti-microbial peptides (AMPs) that constitute an important effector arm of the innate immune system across a wide species range (Ganz 1999) as well as representing a putative link between the innate and adaptive immune responses in higher organisms (Yang et al. 1999). The principle subdivision of the family into α-defensins and β-defensins is characterised by distinctive spacing of cysteine residues in their active peptide regions as well as their tissue expression patterns (Lehrer and Ganz 2002). A third defensin sub-type, θ-defensins, appear to be a recently acquired, primate-specific class of peptides, which are generated by the merging of two α-defensin-like precursors (Tang et al. 1999).

α-Defensins have only been described in mammals, but they are widely distributed in that order (Lynn and Bradley 2007). β-Defensins are the more comprehensively studied sub-class and possess the widest taxonomic distribution, being found in vertebrates and invertebrates as well as plants (Boman 2003), thus indicating an ancient point of origin. Multiple gene duplication events and subsequent sequence diversification in the mammalian lineage has resulted in a large family of proteins with diverse amino acid sequence but virtually identical tertiary structure based on the characteristic disulphide bridging between cysteine residues (Bauer et al. 2001). Recent sequencing of high-quality drafts of many vertebrate genomes has allowed for a comparative genomic approach to be used in characterising the β-defensin repertoire in various species (Schutte et al. 2002; Patil et al. 2005; Radhakrishnan et al. 2005). In species with recent common ancestors, comparable numbers and type of β-defensin have been identified. However, even in closely related species or clades, gain or loss of individual β-defensin genes has been demonstrated—a possible consequence of differing pathogenic insults each individual species faces during the course of its evolution in its own ecological niche (Radhakrishnan et al. 2005).

The bovine lineage was one of the first in which β-defensin-like molecules were discovered (Diamond et al. 1991; Selsted et al. 1993; Tarver et al. 1998). These previous studies resulted in 18 complete and partial bovine β-defensin (BBD) sequences being identified. This number was noticeably smaller than the 35 human, 33 chimp, 38 dog and 45 mouse purportedly functional β-defensin genes subsequently identified by both in silico and laboratory methods (Patil et al. 2005).

In this study, we describe two complementary search strategies for the identification and characterisation of the entire β-defensin repertoire encoded in the bovine genome: the homology-based search methods of the BLAST family of programs (Altschul et al. 1997) and the more sensitive Hidden Markov Models (HMM; Eddy 1998). We have examined the expression of several of these new genes across a wide panel of bovine tissues taken from healthy animals as well as examining the in vitro anti-microbial activity of one new BBD peptide against four common mammalian pathogens, Escherichia coli, Listeria monocytogenes, Salmonella typhimurium and Staphylococcus aureus.

Materials and methods

Bioinformatic identification of bovine AMP orthologs

All publicly available protein sequences corresponding to the known human, mouse and dog β-defensin sequences (Patil et al. 2005) were retrieved from GenBank (http://www.ncbi.nlm.nih.gov/Genbank). The draft 3.1 version of the sequenced and assembled bovine genome was downloaded from Ensembl (http://www.ensembl.org/) and searched using the mammalian β-defensin peptide sequences with the TBLASTN programme (Altschul et al. 1997), which compares the peptide sequence with the deoxyribonucleic acid (DNA) translated in all six reading frames. The subsequent release of the 25,985 Ensembl-predicted bovine gene set was also searched for sequences displaying a high degree of similarity to mammalian β-defensins. To carry out HMM (Eddy 1998) searches of the bovine genome for β-defensin motifs, the entire genome was translated in all six reading frames using a purpose-written Perl script. To generate accurate HMM models representing the β-defensin family, the protein sequences of all β-defensin peptides identified in previous searches of completely sequenced genomes (Patil et al. 2005) were aligned using T-Coffee (Notredame et al. 2000). Homologous sequences including the signature six-cysteine-conserved motif were extracted and used in the construction of the HMM by the hmmbuild program in HMMER 2.1.1 (http://hmer.wustl.edu; Eddy 1998). The generated HMM profile was then searched against the translated genome to identify putative β-defensin-like regions.

Chromosomal location and strand orientation of the identified β-defensins were determined using the BLAST-like Alignment Tool (BLAT) at the University of California—Santa Cruz genome browser (http://genome.ucsc.edu; Kent 2002). Genomic DNA corresponding to putative defensins was retrieved using BLAT and used for prediction of intron/exon boundaries using GenScan (http://genes.mit.edu/GENSCAN.html; Burge and Karlin 1997). The complete repertoire of BBD genes was further analysed by alignment with homologous sequences from other vertebrate species using the T-Coffee multiple sequence alignment programme (Notredame et al. 2000), while neighbour-joining phylogenetic analysis of the proteins was carried out using Mega v.3.1 (Kumar et al. 2001).

Tissue collection, RNA extraction and cDNA synthesis

Tissues were collected at a local abattoir from individual recently euthanised cattle and were immediately flash frozen in liquid nitrogen at the source. Peripheral blood mononuclear cells were extracted from whole blood of uninfected cattle using a Percoll™ gradient (GE Healthcare UK, Buckinghamshire, UK) and previously described methods (Ulmer et al. 1984). Total ribonucleic acid (RNA) was extracted from all tissues using a PRO200 Homogenizer (PRO Scientific) to disrupt cells in the RLT buffer supplied with the RNeasy® mini kit (Qiagen, Crawley, UK) according to the manufacturer’s instructions. Mammary cells were extracted from milk using a protocol as outlined in Sarikaya et al. (2005) and using the RNeasy® lipid tissue minikit. All samples were DNA digested to remove genomic DNA using Qiagen’s on-column DNase and eluted with water. A tissue pool representing RNA pooled from a range of tissues including the liver, mammary gland, lymph node, pituitary gland, hypothalamus, brain, heart, spleen, foetal tissue, ovary and total con A-stimulated leucocytes, was used as a positive control for expression.

RNA was quantified using a NanoDrop® ND-1000 spectrophotometer (Nanodrop Technologies, Wilmington, DE), and purity was assessed on 2% native agarose gels. Single-stranded complementary DNA (cDNA) was synthesised from 1 μg total RNA using oligo dT primers (Promega, Madison, WI) and Omniscript reverse transcriptase (Qiagen). The converted cDNA was then quantified using a NanoDrop® ND-1000 spectrophotometer and diluted to 40 ng/μl working stocks and stored at −20°C for subsequent analyses.

RT-PCR and DNA sequencing

Intron-spanning gene-specific primers (Table 1) for real-time polymerase chain reaction (RT-PCR) were designed, using the Vector NTI Advance™ software package (Invitrogen, Paisley, UK) and commercially synthesised (Invitrogen). Each reaction was carried out in a total volume of 25 μl with 2 μl of cDNA (40 ng/μl), 12.5 μl 2× PCR master mix (Stratagene, La Jolla, CA) and 10.5 μl primer/H2O. Optimal primer concentrations were determined by titrating 100, 300 and 900 nM final concentrations, and RT-PCR was performed using an MX3000P® PCR system (Stratagene) with the cycling parameters as recommended by Stratagene followed by amplicon dissociation. β-Actin was amplified as a positive control in each sample.
Table 1

Known and novel AMP gene details

Gene symbol

Predicted peptide length

qRT-PCR details

Primer sequences (5′–3′)

Genbank accession number

DEFB119

64

161 bp

SF—ACCACGTCCTTCTCCTGTGAC

EU036209

900 nM

SR—AGGTTGAGGATAGTGGACCACT

F—GTTTCTTGCCATCCTTCTGG

R—CATAGAAAGGGAGGCAGCAG

DEFB120

52

115 bp

SF—ATGAAGTTTCTTTTCCTGTTTC

EU036210

900 nM

SR—AGGAGTGGTCCAAGGGAGG

F—TTTCCTGTTTCTTGCCATCC

R—GCAGCGTGTGACACTGTCTT

DEFB122

50

155 bp

SF—CTGAGACTACCTCCTGGGCTCCCTGAA

EU036211

900 nM

SR—GTTATCTTCATTTTTGTGCCCTTGGC

F—CTCTCATCCCAGGTCATTCC

R—GGCGATGTATTTGGCTGAAA

DEFB122a

50

179 bp

SF—CTGAGACTACTCTCTGGGCTCCCTGAA

EU036212

900 nM

SR—TTGTCTTCATTTTTGTGCTCTTGGGC

F—TGCTAACTTTGGCTGCACTG

R—TGGTAAGCCATGTGGTTGGTAC

DEFB123

48

154 bp

SF—CATTGCCGCTTCCCTTGGCC

EU036213

900 nM

SR—TTGATAACTTCAGGCTTCAA

F—AGCTCCTCTCGCTGATTCTG

R—CAGCACAGTTTATTATTTGTGCAGTA

DEFB124

50

190 bp

SF—ATGACACAGCTGCTTCTGCTTC

EU036214

900 nM

SR—GACCTTTTCAGTCTTGACAG

F—TGACACAGCTGCTTCTGCTT

R—TTGACAGGCTTGAGTCCGTA

BNBD4

278 bp

F—GCCAGCATGAGGCTCCATC

NM_174775

900 nM

R—CGTTTAAATTTTAGACGGTGT

BNBD5

143 bp

F—GCCAGCATGAGGCTCCATC

AF014108

900 nM

R—TTGCCAGGGCACGAGATCG

LAP

194 bp

F—GCCAGCATGAGGCTCCATC

AY911374

900 nM

R—CTCCTGCAGCATTTTACTTGGGCT

TAP

184 bp

F—CTCTTCCTGGTCCTGTCTGC

AF014106

300 nM

R—GCTGTGTCTTGGCCTTCTTT

ACTB

118 bp

F—AGATGACCCAGATCATGTTCGA

NM_173979

300 nM

R—TCACCGGAGTCCATCACGAT

qRT-PCR details include amplicon size (bp) and primer concentrations (nM)

Primer sequences denoted forward (F) and reverse (R) and separately, sequencing primers (SF, SR) used to verify novel AMP gene coding sequence, submitted to Genbank.

For gene cDNA sequencing, separate primer sets (SP—Table 1) were designed, and conventional PCR used to amplify the AMP-coding sequences from tissues in which high expression was observed. Each primer pair was optimised using the following protocol. cDNA was amplified in a final volume of 11 μl containing 4.4 pmol of each primer, 200 μM of each deoxyribonucleotide phosphate, 0.5 U of Platinum® Taq polymerase (Invitrogen Life Technologies: invitrogen.com) including 1× reaction buffer (10× buffer consists of 200 mM Tris–HCl pH 8.4, 500 mM KCl). Optimal MgCl2 concentrations were determined by titrating MgCl2 concentration in the 10× PCR mix between 10 and 25 mM in increments of 2.5 mM. PCR amplifications were performed using a PTC-200 thermocycler with a gradient block features (MJ Research: www.mjr.com) with an initial denaturation step for 3 min at 94°C and 40 cycles of 30 s at 93°C, with annealing temperature (Ta) varied across the gradient block from 50 to 65°C for 30 s followed by 72°C for 40 s extension step. The final steps were a 72°C soak for 10 min and a 10°C soak until samples were retrieved. Each sample was then run in a 2% agarose gel using a horizontal gel electrophoresis apparatus (Life Technologies/Whatman-Biometra®: www.biometra.com) in 1× Tris–acetate–ethylenediamine tetraacetic acid buffer with ethidium bromide at 100 V for 30 min. Gels were visualised using an AutoChemi System (Ultra Violet Products). After PCR cleanup using a Qiaquick PCR cleanup kit (Qiagen), samples were sent for commercial sequencing (www.macrogen.com). These sequences were then submitted to Genbank (accession numbers given in Table 1).

Peptide synthesis and functional analysis in vitro

Both BBD123 and human β-defensin 3 (HBD3) peptides were custom synthesised at the Advanced Biotechnology Centre, Imperial College, UK (http://bm-abc01.cx.med.ic.ac.uk/), as previously described (Higgs et al. 2005). The peptides were not specifically folded. The predicted charge of BBD123 peptide is 10.2 and contained 48 amino acid residues as follows:
$${\text{GGTRKCWNFHGRCRHKCFKKEKVYVYCTNNKLCCVKSRYLPKNLPWQI}}{\text{.}}$$

Bacterial cultures

A test panel of common pathogenic bacterial strains was obtained from the National Collection of Type Cultures (NCTC), Central Public Health Laboratory, Colindale, UK: S. aureus NCTC 6571, L. monocytogenes NCTC 11994, E. coli NCTC 9001 and S. typhimurium NCTC 12023. The day before the start of the assay procedure, a starter culture of the required strains were grown up, and on the day of the assay, 2 × 25-ml vials of tryptone soy broth (TSB; Cruinn Diagnostics, Dublin, Ireland) were inoculated with the required number of colonies for 3 h at 37°C and harvested by centrifugation at 1,700 × g for 10 min. The bacterial pellet was resuspended in 20 ml of 10 mM potassium phosphate buffer (pH 7.0) and was serially diluted to the required concentration (~106 CFU/ml) for the assay.

Antimicrobial bioassays

In a 96-well polypropylene plate, 100 μl of potassium phosphate buffer was aliquoted into columns 2, 4, 6, 8, 10 and 12 in rows A and B (duplicates), with negative control wells receiving 100 μl of potassium phosphate buffer with 0.1% TSB. Stock peptide was aliquoted into wells 4A and 4B and serially diluted into columns 6, 8, 10 and 12 using an eight-channel multipipette. Bacterial dilutions were vortexed, poured into sterile Petri dishes and, using an eight-channel pipette, quickly aliquoted to the 96-well plate before the bacteria settled. The plates were incubated for 90 min at 37°C. After incubation, 180 μl of potassium phosphate buffer was aliquoted into rows C to H of columns 2, 4, 6, 8, 10 and 12. The samples were serially diluted (10−1 to 10−3) from rows A/B to G/H. Every other row was left empty to prevent cross-contamination. Each dilution was plated four times using a drop-plate technique on trypticase soy agar (Cruinn Diagnostics). Using an eight-channel pipette, with sterile tips at every other channel, 20 μl of each sample was mixed, removed and spread across the width of the plate. This was repeated three times for each sample, changing the tips for each new plate, resulting in four 20-μl counts for each dilution of each sample. The plates were inverted and incubated overnight at 37°C. The following day, the colonies on each plate were counted. All counts for an individual plate were converted to the same dilution factor and averaged over the four plates. Counts of greater than 100 colonies in any dilution were not included in the calculations. The assay was performed in duplicate from different original bacterial inoculations for each bacterium. The lethal dose (LD50 and LD99) is defined as the minimum concentration of AMP required to kill 50 and 99%, respectively, of viable bacterial cells. Values are expressed in Fig. 4 with error bars indicating standard error of the mean.

Results

Identification and verification of bovine AMP orthologs

Before this study, 18 putative BBDs had been identified through a combination of genomic sequence analysis (Roosen et al. 2004) and direct sequencing of isolated purified proteins from blood neutrophils (Selsted et al. 1993). In the current work, 57 open reading frames (ORFs) bearing a similarity to the characteristic six-cysteine-containing domain of the β-defensin family of genes were identified in a comprehensive bioinformatic search of the sequenced bovine genome (see Supplementary materials). To identify first exons corresponding to each of these second exons sequences, the 5′ upstream genomic region was analysed using the gene prediction software GenScan, as well as homology-based searches using full-length orthologous β-defensin sequences from other species. These methods established possible corresponding first exons for 53 of the 57 β-defensins predicted in the bovine genome. Of the four remaining ORFs, gaps in the sequence of the upstream region or the short nature of the assembled contig are most likely reasons for lack of an associated first exon.

Phylogenetic analysis was carried out using human defensin sequences with our predicted bovine sequences to construct a multiple-sequence alignment (data not shown) and a phylogenetic tree (Fig. 1). Branches, for which an expected two-way orthologous relationship (human/bovine) was established, have been collapsed for ease of viewing. The tree shows the overall conservation of β-defensin sub-groups between the two species. However, the bovine genome appears to encode a number of relatively recent gene duplicates when compared to the human repertoire. BBD122, 125 and 138 are each represented by two genes in the tree, which bear a closer similarity to each other than to any other defensin in the bovine genome. The BBD109 duplicate bovine genes are not included in the figure as no corresponding first exon was predicted for the two mature peptide regions. The duplication and subsequent diversification of these genes in the bovine lineage could be indicative of some species-specific or clade-specific pathogenic challenge against the cow/artiodactyls, which is not a factor for the human lineage. Identification of two distinct, non-identical, β-defensin 109-like genes in clustered porcine sets (data not shown), displaying a high degree of similarity to the bovine predictions, indicates that this particular duplication is a feature of all artiodactyls rather than being bovine specific. By comparison, DEFB109 in humans is represented by two identical copies on chromosome 8 as well as three pseudogenised loci (Semple et al. 2006).
Fig. 1

Neighbour-joining phylogenetic tree constructed using full-length sequences from the bovine and human β-defensin repertoires. Branches with less than 50% bootstrap support have been collapsed. Branches labelled with italicised numbers represent β-defensin families where a human and bovine ortholog have been identified and clustered together in the tree with strong bootstrap support. All human defensin sequences are available at http://www.ncbi.nlm.nih.gov/sites/entrez?db=Protein

Most of the previously identified BBD genes were found to form a separate cluster from those identified in humans. These data coupled with the higher degree of sequence conservation observed between members of this clade would seem to indicate a relatively recent origin for this β-defensin sub-group. To date, this cluster had only been extensively identified in the bovine lineage, although members of this clade have been reported in other artiodactyls including sheep (Huttner et al. 1998), reindeer (UniProt Q0MR48), water buffalo (UniProt A3RJ36) and goat (UniProt Q0PGY0). Of the 18 previously published bovine defensin sequences, the corresponding genomic loci were identified for only 13 in the published bovine genome. Although subsequent, more complete drafts may resolve this issue, the almost identical amino acid composition of a number of these defensins (BNBD7 and DEFB401 differ by a single amino acid) suggests that these previously identified proteins could represent allelic variants of the same gene. We have also identified a new cysteine-containing domain, which has 92% identity with BT402. This sequence (named BNBD14 here) may represent a previously unknown member of this β-defensin sub-group, which seems to be present in a limited mammalian species range. However, no signal peptide coding first exon sequence was apparent in the current genome draft.

The new BBDs were bioinformatically mapped to the March 2007 assembly of the bovine genome to determine genomic organisation of the genes. Where contigs have been assigned to particular chromosomes or multiple β-defensin genes were predicted in a single assembled contig, syntenic positioning of genes was analysed by comparison with dog and human orthologous genomic loci. The fragmentary nature of much of the current bovine genome assembly means that accurate conservation of gene order data is not discernable in many cases. We have determined the complete conservation of the largest mammalian β-defensin cluster—homologous to the canine chromosome 24 and human chromosome 20 clusters—located on chromosome 13 in cow (Fig. 2). The gene order and orientation in the bovine genome is closer to that of dog than the human genome. This agrees with the established phylogenetic relationships of arteriodactyls, carnivores and primates (Murphy et al. 2001).
Fig. 2

Syntenic map of bovine, human and canine β-defensin clusters mapping to bovine chromosome 13

Gene sequences and qualitative analysis of AMP mRNA expression

We have examined the RNA expression of a sub-set of these new β-defensins, in an extensive range of tissues, including those along the respiratory tract (lung), digestive tract (rumen, small intestine, large intestine), reproductive system (uterus, mammary gland, mammary epithelium cells, testis) and representative organs and cells of primary immune function (spleen, liver, lymph node, peripheral blood mononuclear cells) Of the bovine defensin cluster located on chromosome 13, which codes for 18 full-length β-defensin predictions, six cluster member genes (BBD119, BBD120, BBD122, BBD122A BBD123, BBD124) were found to be expressed in our tissue panel. Unlike the previously known BBDs, these novel AMPs show a more restricted pattern of expression (Fig. 3).
Fig. 3

Tissue expression profile of bovine β-defensins. The expression of six novel (BBD119–BBD124) and four known (BNBD4, BNBD5, LAP and TAP) AMPs are shown. Lu Lung, Ru rumen, SI small intestine, LI large intestine, LN lymph node, Lv liver, Sp spleen, MC mammary cells, MG mammary gland, U uterus, Te testis, PB peripheral blood mononuclear cells, TP tissue pool reference cDNA from healthy cattle

Previous studies have indicated that loci orthologous to these bovine genes in other species display disparate expression patterns. Primate expression appears to be restricted exclusively to the male reproductive tract (Radhakrishnan et al. 2005), while rodent orthologs of a number of these novel BBDs have been shown to be expressed in a broader range of tissues than in primates (Radhakrishnan et al. 2007). As in these previous studies, the bovine genes appear to be predominantly expressed in the male reproductive tract, although only the two β-defensin 122-like genes in cattle (BBD122 and BBD122A) show expression restricted to the testis. This pair would appear to be a result of a recent gene duplication event occurring later than the last common ancestor of the bovine and canine lineages. These two peptides are 75% identical in their amino acid composition with all the variability limited to the second exon-encoded active peptide. The duplication and subsequent divergence of the bovine 122 locus, coupled with the pseudogenisation of this gene in humans following the human–macaque split, lends further support to view that increased gene diversity in the β-defensin family can be best described by the birth and death model of evolution (Radhakrishnan et al. 2007). Both BBD119 and BBD120 are expressed in the rumen and testis with BBD119 messenger RNA (mRNA) also detected in the uterus. The neighbouring genes BBD123 and BBD124 display the greatest breadth of tissue expression, although they do not share an identical pattern. Overall, the expression range appears to be most similar for genes located close together on the chromosome providing further support for the hypothesis that tandem duplication of single defensin genes rather than duplication of a large chromosomal chunk is responsible for the “birth” of these genes within the cluster (Radhakrishnan et al. 2005).

Functional testing of novel BBD123 peptide against a pathogen panel

One novel BBD (BBD123) was selected for investigation of its functional activity against a pathogen panel that included both Gram-positive and Gram-negative bacteria (Fig. 4). BBD123 is primarily expressed in the bovine testis but also at lower levels in the uterus, mammary cells, spleen and small intestine. This wide expression in tissues exposed to potential pathogens suggests an important defence role for BBD123. The anti-bacterial activity of the human ortholog (HBD123) of this bovine defensin has previously been investigated (Motzkus et al. 2006), allowing comparison of the activity of this gene in the two species.
Fig. 4

Anti-microbial efficacy of BBD123 against Gram-positive and Gram-negative pathogens

The pathogen panel included E. coli, S. typhimurium (Gram-negative), S. aureus and L. monocytogenes (Gram-positive). In addition to BBD123, the well-characterised HBD3 was tested as a standard reference peptide in each of the bactericidal assays performed. HBD3 has previously been shown to be one of the most potent anti-bacterial β-defensins yet discovered with regard to its anti-bacterial activity (Batoni et al. 2006).

Each pathogen was killed at very low peptide concentrations, with the LD50 varying from 15.6 μg/ml against S. aureus and 7.8 μg/ml against S. typhimurium to 0.9 μg/ml for L. monocytogenes and E. coli (Fig. 4 and Table 2). While the LD99 results for S. typhimurium was 15.6 μg/ml and for S. aureus was greater than 15.6 μg/ml, LD99 values of 3.9 μg/ml were obtained for both L. monocytogenes and E. coli (Fig. 4 and Table 2). In each assay, the BBD123 peptide compared favourably with the results obtained using HBD3 most notably against E. coli (Table 2).
Table 2

Comparison of efficacy of BBD123 and HBD3 against Escherichia coli, Salmonella typhimurium, Staphylococcus aureus and Listeria monocytogenes

 

BBD123

HBD3

LD50

LD99

LD50

LD99

Escherichia coli

0.9

3.9

0.9

3.9

Salmonella typhimurium

7.8

15.6

1.9

7.8

Staphylococcus aureus

15.6

>15.6

0.9

15.6

Listeria monocytogenes

0.9

3.9

<0.9

0.9

Values are listed in μg/ml.

Discussion

The discovery of novel anti-microbials is a welcome development in light of increasing prevalence of antibiotic resistance. AMPs are among the most ancient components of the immune system (Selsted and Ouellette 2005), but their extensive role in mammalian defence has only recently become apparent. We have used the recently released bovine genome sequence to identify novel β-defensin family members in cattle, increasing the count to 57 putative β-defensin genes encoded for in Bos taurus. This is the largest expansion of this gene family identified in any mammalian species. Our phylogenetic tree (Fig. 1) of the novel bovine defensins with the human repertoire indicates the discontinuous nature of the β-defensin catalogue in mammals, where individual defensin genes can be either gained or lost in a particular species, possibly because of selective pressures exerted on that lineage. In the process of domestication, cattle were subjected to much higher population densities than wild bovids. This would have exposed them to a greater abundance and diversity of microbes. This may explain why the bovine genome appears to host the highest number of β-defensins of any mammal. This is also a plausible explanation for the positive selection signatures reported in the bovine specific β-defensins (Luenser and Ludwig 2005). Preliminary analysis (data not shown) indicates that positive selection has influenced the evolution of bovine genes in the syntenic cluster under discussion here.

The PCR-amplified mRNA products were sequenced to verify the accuracy of the bioinformatic predictions. A tissue expression profile for several novel β-defensins have been generated from tissues derived from a healthy animal, indicating that these genes are constitutively expressed under normal conditions. Genes for which no expression data have been determined may yet be found in tissues not examined in our panel, or expression may only be induced after infection by specific pathogens. It seems plausible that the expression of particular β-defensin genes in a tissue would indicate a site of infection for whatever specific pathogens these genes counteract. Therefore, the conservation of these defensins across a wide mammalian species range, coupled with the differing tissue expression ranges in rodents, primates and cattle could indicate that the actual sites of infection for a microbe can vary greatly in different host species. Alternatively, small changes in amino acid composition in the active peptide may change the pathogen specificity of particular orthologous peptides in different species.

It is generally regarded that mammalian cationic AMPs are broad spectrum with anti-microbial activity against a range of human and animal pathogens (Brogden et al. 2003). mRNA expression of two of the known AMPs—lingual anti-microbial peptide (LAP) and tracheal anti-microbial peptide (TAP)—has been recently detected in the mammary glands of healthy and infected cattle (Roosen et al. 2004). Initial studies primarily focused on respiratory tract expression and function (Russell et al. 1996). In our study, we also detect expression of both LAP and TAP in the lung (Fig. 3) but also demonstrate wider expression and possible function of these AMPs across tissues of the reproductive and immune systems. Furthermore, LAP has been demonstrated to be expressed and inducible in tissue epithelial cells in response to mastitis in cattle (Swanson et al. 2004). Our studies confirm the expression of both TAP and LAP in mammary epithelium as well as mammary tissue (Fig. 3). The broad spectrum of anti-microbial properties found for LAP (Schonwetter et al. 1995) correlates with the non-specific pattern of tissue expression we detected (Fig. 3).

Similarly, BNBD4 and BNBD5, originally derived from neutrophils (Selsted et al. 1993), are also expressed across the tissue panel selected, suggesting wider constitutive functions. Induced expression of BNBD5 has been demonstrated in mammary tissue in response to bovine mastitis (Goldammer et al. 2004). Our results show the expression of both BNBD4 and BNBD5 in mammary gland and mammary epithelial cells.

The pathogen panel tested included both Gram-negative and Gram-positive bacteria that are common cattle pathogens representing a significant cost to agriculture as well as posing problems for food safety and human health. E. coli and S. aureus are common causes of mastitis in cattle, while S. typhimurium and L. monocytogenes can cause gastrointestinal problems such as listeriosis and salmonellosis in both animals and man. Importantly, many of these pathogens, especially S. aureus, are developing increased resistance to conventional antibiotics. Certain strains of E. coli and S. typhimurium can exist as commensals in cow (Bettelheim et al. 1974), although it is possible that AMPs play a role in controlling such benign populations as well as the more pathogenic strains (Zasloff 2002). The low LD50 and LD99 of the BBD123 peptide, necessary for killing all four pathogens tested, indicate the potential application of AMPs as novel anti-microbials against both Gram-positive and Gram-negative bacteria. A previous study investigating HBD123 reported a minimal inhibitory concentration (MIC) of 75 and 37.5 μg/ml against S. aureus and E. coli, respectively (Motzkus et al. 2006). Although the reported HBD123 activity cannot be directly compared to our own findings because of the use of different anti-microbial assays, it appears that the anti-microbial activity of these orthologuos peptides is different. The proteins differ at 19 out of 48 amino acid residues in the active region, with these changes possibly contributing to the differences in killing efficiency. Similarly, the use of BBD123 improves on the efficacy previously published using other bovine AMPs against these pathogens. TAP, for example, has been shown to kill E. coli with a MIC of 12–25 μg/ml and S. aureus with a MIC of 25–50 μg/ml (Diamond et al. 1991), as against 0.9 and 15.6 μg/ml for BBD123 against E. coli and S. aureus, respectively (Table 2). It is noted that BBD123 and HBD3 display different potencies against both Gram-positive and Gram-negative bacteria. As a consequence, we speculate that neither the Gram-positive nor Gram-negative status of a bacterial membrane is a major contributing factor in susceptibility of a microbe to β-defensins.

The constitutive expression of these novel genes suggests that circulating levels of AMPs are necessary for optimal immune protection. It is clear that BBDs, as in other species, are very diverse with respect to amino acid sequence, tissue expression pattern and target pathogens. It is possible that some of the variation in these characteristics within the β-defensin family may be related to additional functions distinct from the direct anti-bacterial action (Elsbach 2003). It is probable given the diverse roles that are currently being catalogued for known AMPs that the role of these novel AMPs in the bovine immune response under normal and inflammatory conditions will prove to be pleiotropic.

Notes

Acknowledgements

This work was supported by the Department of Agriculture (Food Institutional Research Measure) funding. The bovine tissue pool RNA was kindly donated by Dr. David MacHugh, Animal Genomics Laboratory, School of Agriculture, Food Science and Veterinary Medicine, UCD.

Supplementary material

251_2007_269_MOESM1_ESM.txt (5 kb)
Supplementary materialsPeptide sequences for all β-defensins sequences coded for in the Bovine Genome Release 3.1 (TXT 5.03 KB)

References

  1. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 25:3389–3402PubMedCrossRefGoogle Scholar
  2. Batoni G, Maisetta G, Esin S, Campa M (2006) Human beta-defensin-3: a promising antimicrobial peptide. Mini Rev Med Chem 6:1063–1073PubMedCrossRefGoogle Scholar
  3. Bauer F, Schweimer K, Kluver E, Conejo-Garcia JR, Forssmann WG, Rosch P, Adermann K, Sticht H (2001) Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity. Protein Sci 10:2470–2479PubMedCrossRefGoogle Scholar
  4. Bettelheim KA, Bushrod FM, Chandler ME, Cooke EM, O’Farrell S, Shooter RA (1974) Escherichia coli serotype distribution in man and animals. J Hyg (Lond) 73:467–471Google Scholar
  5. Boman HG (2003) Antibacterial peptides: basic facts and emerging concepts. J Intern Med 254:197–215PubMedCrossRefGoogle Scholar
  6. Brogden KA, Ackermann M, McCray PB Jr, Tack BF (2003) Antimicrobial peptides in animals and their role in host defences. Int J Antimicrob Agents 22:465–478PubMedCrossRefGoogle Scholar
  7. Burge C, Karlin S (1997) Prediction of complete gene structures in human genomic DNA. J Mol Biol 268:78–94PubMedCrossRefGoogle Scholar
  8. Diamond G, Zasloff M, Eck H, Brasseur M, Maloy WL, Bevins CL (1991) Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA. Proc Natl Acad Sci USA 88:3952–3956PubMedCrossRefGoogle Scholar
  9. Eddy SR (1998) Profile hidden Markov models. Bioinformatics 14:755–763PubMedCrossRefGoogle Scholar
  10. Elsbach P (2003) What is the real role of antimicrobial polypeptides that can mediate several other inflammatory responses? J Clin Invest 111:1643–1645PubMedGoogle Scholar
  11. Ganz T (1999) Defensins and host defense. Science 286:420–421PubMedCrossRefGoogle Scholar
  12. Goldammer T, Zerbe H, Molenaar A, Schuberth HJ, Brunner RM, Kata SR, Seyfert HM (2004) Mastitis increases mammary mRNA abundance of beta-defensin 5, toll-like-receptor 2 (TLR2), and TLR4 but not TLR9 in cattle. Clin Diagn Lab Immunol 11:174–185PubMedCrossRefGoogle Scholar
  13. Higgs R, Lynn DJ, Gaines S, McMahon J, Tierney J, James T, Lloyd AT, Mulcahy G, O’Farrelly C (2005) The synthetic form of a novel chicken beta-defensin identified in silico is predominantly active against intestinal pathogens. Immunogenetics 57:90–98PubMedCrossRefGoogle Scholar
  14. Huttner KM, Lambeth MR, Burkin HR, Burkin DJ, Broad TE (1998) Localization and genomic organization of sheep antimicrobial peptide genes. Gene 206:85–91PubMedCrossRefGoogle Scholar
  15. Kent WJ (2002) BLAT–the BLAST-like alignment tool. Genome Res 12:656–664PubMedCrossRefGoogle Scholar
  16. Kumar S, Tamura K, Jakobsen IB, Nei M (2001) MEGA2: molecular evolutionary genetics analysis software. Bioinformatics 17:1244–1245PubMedCrossRefGoogle Scholar
  17. Lehrer RI, Ganz T (2002) Defensins of vertebrate animals. Curr Opin Immunol 14:96–102PubMedCrossRefGoogle Scholar
  18. Luenser K, Ludwig A (2005) Variability and evolution of bovine beta-defensin genes. Genes Immun 6:115–122PubMedCrossRefGoogle Scholar
  19. Lynn DJ, Bradley DG (2007) Discovery of alpha-defensins in basal mammals. Dev Comp Immunol 31:963–967PubMedCrossRefGoogle Scholar
  20. Motzkus D, Schulz-Maronde S, Heitland A, Schulz A, Forssmann WG, Jubner M, Maronde E (2006) The novel beta-defensin DEFB123 prevents lipopolysaccharide-mediated effects in vitro and in vivo. Faseb J 20:1701–1702PubMedCrossRefGoogle Scholar
  21. Murphy WJ, Eizirik E, O’Brien SJ, Madsen O, Scally M, Douady CJ, Teeling E, Ryder OA, Stanhope MJ, de Jong WW, Springer MS (2001) Resolution of the early placental mammal radiation using Bayesian phylogenetics. Science 294:2348–2351PubMedCrossRefGoogle Scholar
  22. Notredame C, Higgins DG, Heringa J (2000) T-Coffee: a novel method for fast and accurate multiple sequence alignment. J Mol Biol 302:205–217PubMedCrossRefGoogle Scholar
  23. Patil AA, Cai Y, Sang Y, Blecha F, Zhang G (2005) Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract. Physiol Genomics 23:5–17PubMedCrossRefGoogle Scholar
  24. Radhakrishnan Y, Hamil KG, Yenugu S, Young SL, French FS, Hall SH (2005) Identification, characterization, and evolution of a primate beta-defensin gene cluster. Genes Immun 6:203–210PubMedCrossRefGoogle Scholar
  25. Radhakrishnan Y, Fares MA, French FS, Hall SH (2007) Comparative genomic analysis of a mammalian β-defensin gene cluster. Physiol Genomics 30:213–222PubMedCrossRefGoogle Scholar
  26. Roosen S, Exner K, Paul S, Schroder JM, Kalm E, Looft C (2004) Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue. Mamm Genome 15:834–842PubMedCrossRefGoogle Scholar
  27. Russell JP, Diamond G, Tarver AP, Scanlin TF, Bevins CL (1996) Coordinate induction of two antibiotic genes in tracheal epithelial cells exposed to the inflammatory mediators lipopolysaccharide and tumor necrosis factor alpha. Infect Immun 64:1565–1568PubMedGoogle Scholar
  28. Sarikaya H, Werner-Misof C, Atzkern M, Bruckmaier RM (2005) Distribution of leucocyte populations, and milk composition, in milk fractions of healthy quarters in dairy cows. J Dairy Res 72:486–492PubMedCrossRefGoogle Scholar
  29. Schonwetter BS, Stolzenberg ED, Zasloff MA (1995) Epithelial antibiotics induced at sites of inflammation. Science 267:1645–1648PubMedCrossRefGoogle Scholar
  30. Schutte BC, Mitros JP, Bartlett JA, Walters JD, Jia HP, Welsh MJ, Casavant TL, McCray PB Jr (2002) Discovery of five conserved beta-defensin gene clusters using a computational search strategy. Proc Natl Acad Sci USA 99:2129–2133PubMedCrossRefGoogle Scholar
  31. Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS (1993) Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils. J Biol Chem 268:6641–6648PubMedGoogle Scholar
  32. Selsted ME, Ouellette AJ (2005) Mammalian defensins in the antimicrobial immune response. Nat Immunol 6:551–557PubMedCrossRefGoogle Scholar
  33. Semple CA, Gautier P, Taylor K, Dorin JR (2006) The changing of the guard: molecular diversity and rapid evolution of beta-defensins. Mol Divers 10:575–584PubMedCrossRefGoogle Scholar
  34. Swanson K, Gorodetsky S, Good L, Davis S, Musgrave D, Stelwagen K, Farr V, Molenaar A (2004) Expression of a beta-defensin mRNA, lingual antimicrobial peptide, in bovine mammary epithelial tissue is induced by mastitis. Infect Immun 72:7311–7314PubMedCrossRefGoogle Scholar
  35. Tang YQ, Yuan J, Osapay G, Osapay K, Tran D, Miller CJ, Ouellette AJ, Selsted ME (1999) A cyclic antimicrobial peptide produced in primate leukocytes by the ligation of two truncated alpha-defensins. Science 286:498–502PubMedCrossRefGoogle Scholar
  36. Tarver AP, Clark DP, Diamond G, Russell JP, Erdjument-Bromage H, Tempst P, Cohen KS, Jones DE, Sweeney RW, Wines M, Hwang S, Bevins CL (1998) Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection. Infect Immun 66:1045–1056PubMedGoogle Scholar
  37. Ulmer AJ, Scholz W, Ernst M, Brandt E, Flad HD (1984) Isolation and subfractionation of human peripheral blood mononuclear cells (PBMC) by density gradient centrifugation on Percoll. Immunobiology 166:238–250PubMedGoogle Scholar
  38. Yang D, Chertov O, Bykovskaia SN, Chen Q, Buffo MJ, Shogan J, Anderson M, Schroder JM, Wang JM, Howard OM, Oppenheim JJ (1999) Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286:525–528PubMedCrossRefGoogle Scholar
  39. Zasloff M (2002) Innate immunity, antimicrobial peptides, and protection of the oral cavity. Lancet 360:1116–1117PubMedCrossRefGoogle Scholar

Copyright information

© Springer-Verlag 2007

Authors and Affiliations

  • Paul Cormican
    • 1
  • Kieran G. Meade
    • 1
  • Sarah Cahalane
    • 1
  • Fernando Narciandi
    • 1
  • Aspinas Chapwanya
    • 1
  • Andrew T. Lloyd
    • 1
  • Cliona O’Farrelly
    • 1
  1. 1.School of Biochemistry and ImmunologyTrinity College DublinDublinIreland

Personalised recommendations